DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5A and cox5aa

DIOPT Version :9

Sequence 1:NP_001262488.1 Gene:COX5A / 41432 FlyBaseID:FBgn0019624 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001019574.1 Gene:cox5aa / 554101 ZFINID:ZDB-GENE-050522-133 Length:141 Species:Danio rerio


Alignment Length:138 Identity:73/138 - (52%)
Similarity:91/138 - (65%) Gaps:11/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SALRSSLVGTSS----------RVAAVRCLHGTEESAEEFDKRYEKYFSREGIDGWEIRKGMNDL 65
            :|||.|..|..|          .|||....||.:|:.||||.|:..|||:..||.||:|||||.|
Zfish     4 AALRLSFSGARSLARSRPQYTASVAARSYSHGKQETDEEFDARWVTYFSKPDIDAWELRKGMNTL 68

  Fly    66 LGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGCKDKCGDQKATLYPYLLEKITPTLQELGIPT 130
            :|.||||.|||::|.|||.||::|:|.|||.||..|||.|..| .:|||:::::.|||.||||.|
Zfish    69 IGYDLVPEPKILDAALRACRRLDDLASAIRILEAVKDKAGPHK-EIYPYVIQELRPTLDELGIAT 132

  Fly   131 IEELGYDK 138
            .||||.||
Zfish   133 PEELGIDK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5ANP_001262488.1 Cyt_c_Oxidase_Va 33..136 CDD:238463 59/102 (58%)
cox5aaNP_001019574.1 Cyt_c_Oxidase_Va 36..137 CDD:238463 58/101 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596293
Domainoid 1 1.000 125 1.000 Domainoid score I5420
eggNOG 1 0.900 - - E1_KOG4077
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37905
Inparanoid 1 1.050 135 1.000 Inparanoid score I4559
OMA 1 1.010 - - QHG52416
OrthoDB 1 1.010 - - D1286549at2759
OrthoFinder 1 1.000 - - FOG0005121
OrthoInspector 1 1.000 - - otm25949
orthoMCL 1 0.900 - - OOG6_104716
Panther 1 1.100 - - LDO PTHR14200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R247
SonicParanoid 1 1.000 - - X3641
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.