DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5A and cox6

DIOPT Version :9

Sequence 1:NP_001262488.1 Gene:COX5A / 41432 FlyBaseID:FBgn0019624 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_593931.1 Gene:cox6 / 2542493 PomBaseID:SPAC1B2.04 Length:140 Species:Schizosaccharomyces pombe


Alignment Length:104 Identity:40/104 - (38%)
Similarity:60/104 - (57%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HGTEESAEEFDKRYEKYFSREGIDGWEIRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIR 95
            ||.  |.||.:.:|..:||... |.:|:::|:|:....|:|||..:||..|||:|||||...|:|
pombe    40 HGV--SLEEINTKYNDFFSNVQ-DQFELQRGLNNCFAYDIVPSSDVIEQALRAARRVNDFPTAVR 101

  Fly    96 WLEGCKDKCGDQKATLYPYLLEKITPTLQELGIPTIEEL 134
            ..||.|.|...::.  |...::::.|...||||...|:|
pombe   102 IFEGIKVKLPTKEQ--YQAYVKELKPVCNELGIVLKEDL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5ANP_001262488.1 Cyt_c_Oxidase_Va 33..136 CDD:238463 38/102 (37%)
cox6NP_593931.1 Cyt_c_Oxidase_Va 40..140 CDD:238463 40/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2763
eggNOG 1 0.900 - - E1_KOG4077
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1945
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005121
OrthoInspector 1 1.000 - - oto101172
orthoMCL 1 0.900 - - OOG6_104716
Panther 1 1.100 - - LDO PTHR14200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R247
SonicParanoid 1 1.000 - - X3641
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.