DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5A and cox-5A

DIOPT Version :9

Sequence 1:NP_001262488.1 Gene:COX5A / 41432 FlyBaseID:FBgn0019624 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_499681.1 Gene:cox-5A / 176707 WormBaseID:WBGene00012553 Length:174 Species:Caenorhabditis elegans


Alignment Length:150 Identity:66/150 - (44%)
Similarity:97/150 - (64%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSIT--ARNLASALRSSL--VGTSSRVAAVRCLHGTE----ESAEEFDKRYEKYFSREGIDGWE 57
            |.|:|  ...||.|.|.::  :.|::.|:.    ||.:    ..|::||..:..|.:|..|||||
 Worm     1 MASLTRAVTRLAIAGRQAVRTIATTTPVSG----HGDDIMEKWPADKFDNHFINYLNRPEIDGWE 61

  Fly    58 IRKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGCKDKCGDQK--ATLYPYLLEKIT 120
            :||.:::|...|::|.||::||.|||.|||||.|||:|:||..|.|||.||  .|:|.|:::::.
 Worm    62 VRKALSELHDYDVIPDPKVVEAALRACRRVNDFALAVRFLEAIKIKCGAQKNRDTVYAYIVKQVE 126

  Fly   121 PTLQELGIPTIEELGYDKPE 140
            |.|:||||.|.|:|||.:||
 Worm   127 PVLKELGIDTPEQLGYGEPE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5ANP_001262488.1 Cyt_c_Oxidase_Va 33..136 CDD:238463 51/108 (47%)
cox-5ANP_499681.1 Cyt_c_Oxidase_Va 37..142 CDD:238463 51/104 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167518
Domainoid 1 1.000 115 1.000 Domainoid score I3792
eggNOG 1 0.900 - - E1_KOG4077
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37905
Inparanoid 1 1.050 119 1.000 Inparanoid score I3351
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1286549at2759
OrthoFinder 1 1.000 - - FOG0005121
OrthoInspector 1 1.000 - - oto18697
orthoMCL 1 0.900 - - OOG6_104716
Panther 1 1.100 - - LDO PTHR14200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R247
SonicParanoid 1 1.000 - - X3641
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.