DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5A and Cox5a

DIOPT Version :9

Sequence 1:NP_001262488.1 Gene:COX5A / 41432 FlyBaseID:FBgn0019624 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_031773.2 Gene:Cox5a / 12858 MGIID:88474 Length:146 Species:Mus musculus


Alignment Length:145 Identity:73/145 - (50%)
Similarity:94/145 - (64%) Gaps:16/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LASALRSSLVGTSSR--------------VAAVRCL-HGTEESAEEFDKRYEKYFSREGIDGWEI 58
            ||:|||......::|              |.::||. ||:.|:.||||.|:..||::..||.||:
Mouse     2 LAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPDIDAWEL 66

  Fly    59 RKGMNDLLGMDLVPSPKIIEAGLRASRRVNDIALAIRWLEGCKDKCGDQKATLYPYLLEKITPTL 123
            |||||.|:|.||||.||||:|.|||.||:||.|.|:|.||..|||.|..| .:|||:::::.|||
Mouse    67 RKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHK-EIYPYVIQELRPTL 130

  Fly   124 QELGIPTIEELGYDK 138
            .||||.|.||||.||
Mouse   131 NELGISTPEELGLDK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5ANP_001262488.1 Cyt_c_Oxidase_Va 33..136 CDD:238463 59/102 (58%)
Cox5aNP_031773.2 Cyt_c_Oxidase_Va 41..142 CDD:238463 58/101 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850373
Domainoid 1 1.000 122 1.000 Domainoid score I5651
eggNOG 1 0.900 - - E1_KOG4077
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37905
Inparanoid 1 1.050 136 1.000 Inparanoid score I4540
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52416
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005121
OrthoInspector 1 1.000 - - oto93384
orthoMCL 1 0.900 - - OOG6_104716
Panther 1 1.100 - - LDO PTHR14200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R247
SonicParanoid 1 1.000 - - X3641
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.