DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and AT3G20890

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_188725.3 Gene:AT3G20890 / 821638 AraportID:AT3G20890 Length:292 Species:Arabidopsis thaliana


Alignment Length:411 Identity:90/411 - (21%)
Similarity:129/411 - (31%) Gaps:198/411 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VKLRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREK 212
            |:|||||:...|..:.|||.|||:    ..:||| .|..:.|||||.........:.||.:||:.
plant    59 VRLRGLPFDCAELDVVEFFHGLDV----VDVLFV-HRNNKVTGEAFCVLGYPLQVDFALQKNRQN 118

  Fly   213 IGHRYIEIFRSSIAEMKRATGAGGGVGGRPGPYDIRDRGANRGGNDFGGGRNDWGNNGNFGVGAN 277
            :|.||:|:|||:..|..:|                                              
plant   119 MGRRYVEVFRSTKQEYYKA---------------------------------------------- 137

  Fly   278 NMLGFNNLPSLMNSGNFGNNQGGNNGNFGNNSGPSNFGNFGGGNNGGNSGNFGNDSGNSGNFGNF 342
                                                               ..|:...|...|..
plant   138 ---------------------------------------------------IANEVAESRVHGMA 151

  Fly   343 GNNGGGNFGGNNNGGGGFNSGNNFNSPGGVNNFGNNGGSNFGGNGGGGFNNGGNFVSSSGVGNFG 407
            ...|||..|||.:||||                        ||.||||..:||:          .
plant   152 SGGGGGLGGGNGSGGGG------------------------GGGGGGGRISGGS----------S 182

  Fly   408 P---IGGGRNNNNGNFGNSGFGNFGGNNNVGSNFGGGNNGGGGGFNNGSNFGGGNSMGGGGNFGP 469
            |   :...|::::|.                                                  
plant   183 PRRHVQRARSSDDGK-------------------------------------------------- 197

  Fly   470 IGGGRGNDIEYYTI-HMRGLPYTSFENDVFKFFEPIRPAN--VRINYNKKGLHSGTADAYFDTYE 531
                  .|||:..| .:||||:::.:.|:..||:....:.  |.:..|.:|..:|.|...|...|
plant   198 ------EDIEHTGILRLRGLPFSAGKEDILDFFKDFELSEDFVHVTVNGEGRPTGEAFVEFRNAE 256

  Fly   532 DSQVAMKRHREQMGSRYIELF 552
            ||:.||.:.|:.:||||||||
plant   257 DSRAAMVKDRKTLGSRYIELF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621
RRM2_hnRNPH_like 146..224 CDD:240948 32/75 (43%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950 28/75 (37%)
AT3G20890NP_188725.3 RRM_hnRNPH_ESRPs_RBM12_like 60..127 CDD:409699 29/71 (41%)
RRM_hnRNPH_ESRPs_RBM12_like 205..277 CDD:409699 26/71 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3754
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D603679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm959
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13976
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X436
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.