Sequence 1: | NP_650120.1 | Gene: | glo / 41431 | FlyBaseID: | FBgn0259139 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001352193.1 | Gene: | ESRP2 / 80004 | HGNCID: | 26152 | Length: | 727 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 67/201 - (33%) |
---|---|---|---|
Similarity: | 106/201 - (52%) | Gaps: | 21/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 NVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVE 107
Fly 108 EARKLNKASMGHRYIEVFTATPKEAKEAMRKISGHGTAF------------VVKLRGLPYAVTEQ 160
Fly 161 QIEEFFS-GLDIKTDREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224
Fly 225 IAEMKR 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
glo | NP_650120.1 | RRM_SF | 51..125 | CDD:302621 | 25/73 (34%) |
RRM2_hnRNPH_like | 146..224 | CDD:240948 | 28/90 (31%) | ||
RRM3_hnRNPH_CRSF1_like | 481..555 | CDD:240950 | |||
ESRP2 | NP_001352193.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
DnaQ_like_exo | <86..214 | CDD:324557 | |||
RRM1_ESRPs_Fusilli | 258..332 | CDD:240951 | 26/76 (34%) | ||
RRM_SF | 342..448 | CDD:327398 | 34/103 (33%) | ||
RRM3_ESRP1_ESRP2 | 474..554 | CDD:241186 | |||
Atrophin-1 | <565..676 | CDD:331285 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165155211 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.800 |