DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and ESRP2

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001352193.1 Gene:ESRP2 / 80004 HGNCID:26152 Length:727 Species:Homo sapiens


Alignment Length:201 Identity:67/201 - (33%)
Similarity:106/201 - (52%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVE 107
            :|.:|...||.|||||.::.:::..|.:.:||..|...:.|   ...|:..|||.:.....|..:
Human   251 DVVDSETVVRARGLPWQSSDQDVARFFKGLNVARGGVALCL---NAQGRRNGEALIRFVDSEQRD 312

  Fly   108 EARKLNKASMGHRYIEVFTATPKEAKEAMRKISGHGTAF------------VVKLRGLPYAVTEQ 160
            .|.:.:|..||.|||||:.||.:|    ..||:| ||:.            :::|||||::....
Human   313 LALQRHKHHMGVRYIEVYKATGEE----FVKIAG-GTSLEVARFLSREDQVILRLRGLPFSAGPT 372

  Fly   161 QIEEFFS-GLDIKTDREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224
            .:..|.. ...:....||:|||....||.||:||..|..::..:.||.|::..:|.||||:|||:
Human   373 DVLGFLGPECPVTGGTEGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGMLGKRYIELFRST 437

  Fly   225 IAEMKR 230
            .||:::
Human   438 AAEVQQ 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 25/73 (34%)
RRM2_hnRNPH_like 146..224 CDD:240948 28/90 (31%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
ESRP2NP_001352193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
DnaQ_like_exo <86..214 CDD:324557
RRM1_ESRPs_Fusilli 258..332 CDD:240951 26/76 (34%)
RRM_SF 342..448 CDD:327398 34/103 (33%)
RRM3_ESRP1_ESRP2 474..554 CDD:241186
Atrophin-1 <565..676 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.