DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and Rbm12b1

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_082502.2 Gene:Rbm12b1 / 72397 MGIID:1919647 Length:836 Species:Mus musculus


Alignment Length:235 Identity:54/235 - (22%)
Similarity:93/235 - (39%) Gaps:72/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKA 115
            :||.|||:.|...:|..|.:.:.:.:|  |:|::     |...|||::..|:.||...|...:..
Mouse     5 IRLLGLPFIAGPVDIRHFFKGLTIPDG--GVHII-----GGKVGEAFIIFATDEDARRAISRSGG 62

  Fly   116 SMGHRYIEVFTATPKEAKEAM---------------------------------RKISGHGTAF- 146
            .:....:|:|.::..|.::.:                                 ...||:|::. 
Mouse    63 FIKDSSVELFLSSKVEMQKTIEMKRTARVGRGRPGSGASGVGNVYHFSDALKEEESYSGYGSSVN 127

  Fly   147 ---------------------------VVKLRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDR 184
                                       .:.||||||.|.|..:..|||||.:    :|::.:...
Mouse   128 RDAGFHTNGTGLDLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCV----DGVILLKHH 188

  Fly   185 RGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224
            .||..|:|.|:|.|..|....|..:|..:|.|:||:.:.|
Mouse   189 DGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFIEVMQGS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 20/73 (27%)
RRM2_hnRNPH_like 146..224 CDD:240948 28/105 (27%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
Rbm12b1NP_082502.2 RRM_SF 2..80 CDD:418427 22/81 (27%)
RRM2_RBM12B 152..237 CDD:410140 29/81 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..277
RRM_SF 283..362 CDD:418427
RRM <367..559 CDD:223796
RRM4_RBM12B 401..476 CDD:410142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 539..572
PTZ00465 <601..708 CDD:185644
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 620..644
RRM_SF 760..836 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.