Sequence 1: | NP_650120.1 | Gene: | glo / 41431 | FlyBaseID: | FBgn0259139 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082502.2 | Gene: | Rbm12b1 / 72397 | MGIID: | 1919647 | Length: | 836 | Species: | Mus musculus |
Alignment Length: | 235 | Identity: | 54/235 - (22%) |
---|---|---|---|
Similarity: | 93/235 - (39%) | Gaps: | 72/235 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 VRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKA 115
Fly 116 SMGHRYIEVFTATPKEAKEAM---------------------------------RKISGHGTAF- 146
Fly 147 ---------------------------VVKLRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDR 184
Fly 185 RGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
glo | NP_650120.1 | RRM_SF | 51..125 | CDD:302621 | 20/73 (27%) |
RRM2_hnRNPH_like | 146..224 | CDD:240948 | 28/105 (27%) | ||
RRM3_hnRNPH_CRSF1_like | 481..555 | CDD:240950 | |||
Rbm12b1 | NP_082502.2 | RRM_SF | 2..80 | CDD:418427 | 22/81 (27%) |
RRM2_RBM12B | 152..237 | CDD:410140 | 29/81 (36%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 237..277 | ||||
RRM_SF | 283..362 | CDD:418427 | |||
RRM | <367..559 | CDD:223796 | |||
RRM4_RBM12B | 401..476 | CDD:410142 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 539..572 | ||||
PTZ00465 | <601..708 | CDD:185644 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 620..644 | ||||
RRM_SF | 760..836 | CDD:418427 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167845694 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |