DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and esrp2

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_954966.1 Gene:esrp2 / 572992 ZFINID:ZDB-GENE-030131-9824 Length:736 Species:Danio rerio


Alignment Length:227 Identity:74/227 - (32%)
Similarity:119/227 - (52%) Gaps:22/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DNFNDDSNQQQDEDDQYNEDGGGKIENVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGI 81
            |.:|...:..:..:.::......|.|.| :|...:|.|||||.::.::|..|.:.:|:..|...:
Zfish   193 DPYNHKFSAFETVNYKFESGACSKTEAV-DSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVAL 256

  Fly    82 HLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKASMGHRYIEVFTATPKEAKEAMRKISGHGTA- 145
            .|   ...|:..|||.|...:.|..:.|...:|..||.|||||:.||.:|    ..||:| ||: 
Zfish   257 CL---NAQGRRNGEALVRFINSEHRDMALDRHKHHMGSRYIEVYKATGEE----FLKIAG-GTSN 313

  Fly   146 -----------FVVKLRGLPYAVTEQQIEEFFSGLDIKTD-REGILFVMDRRGRATGEAFVQFES 198
                       .::::||||:..|.|.:..|.......|| .||:|||....||.||:|||.|..
Zfish   314 EVAQFLSKENQMIIRMRGLPFTATPQDVLGFLGPECPVTDGTEGLLFVKYPDGRPTGDAFVLFAC 378

  Fly   199 QDDTEQALGRNREKIGHRYIEIFRSSIAEMKR 230
            ::..:.||.::::.:|.||||:|||:.||:::
Zfish   379 EEYAQNALKKHKQILGKRYIELFRSTAAEVQQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 25/73 (34%)
RRM2_hnRNPH_like 146..224 CDD:240948 31/78 (40%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
esrp2NP_954966.1 DnaQ_like_exo 8..165 CDD:299142
RRM_SF 225..304 CDD:302621 29/85 (34%)
RRM2_ESRP2 309..415 CDD:241184 37/103 (36%)
RRM3_ESRP1_ESRP2 449..529 CDD:241186
WWbp <572..658 CDD:304964
RRM_hnRNPH_ESRPs_RBM12_like 661..732 CDD:240700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.