Sequence 1: | NP_650120.1 | Gene: | glo / 41431 | FlyBaseID: | FBgn0259139 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005158084.1 | Gene: | esrp1 / 560190 | ZFINID: | ZDB-GENE-070112-1732 | Length: | 718 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 76/204 - (37%) |
---|---|---|---|
Similarity: | 117/204 - (57%) | Gaps: | 22/204 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 KIENVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQE 104
Fly 105 DVEEARKLNKASMGHRYIEVFTATPKEAKEAMRKISGHGTA------------FVVKLRGLPYAV 157
Fly 158 TEQQIEEFFSGLDIKTD-REGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIF 221
Fly 222 RSSIAEMKR 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
glo | NP_650120.1 | RRM_SF | 51..125 | CDD:302621 | 27/73 (37%) |
RRM2_hnRNPH_like | 146..224 | CDD:240948 | 34/78 (44%) | ||
RRM3_hnRNPH_CRSF1_like | 481..555 | CDD:240950 | |||
esrp1 | XP_005158084.1 | DnaQ_like_exo | 7..174 | CDD:299142 | |
RRM1_ESRP1 | 221..305 | CDD:241180 | 32/91 (35%) | ||
RRM | <272..502 | CDD:223796 | 56/145 (39%) | ||
RRM_SF | 310..416 | CDD:302621 | 40/103 (39%) | ||
RRM3_ESRP1_ESRP2 | 449..529 | CDD:241186 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170590305 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.800 |