DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and esrp1

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_005158084.1 Gene:esrp1 / 560190 ZFINID:ZDB-GENE-070112-1732 Length:718 Species:Danio rerio


Alignment Length:204 Identity:76/204 - (37%)
Similarity:117/204 - (57%) Gaps:22/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KIENVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQE 104
            |:|.|.:: ..:|.|||||.::.::|..|...:|:..|.|.:.|   ...|:..|||.|...|:|
Zfish   217 KMERVDDN-TVIRARGLPWQSSDQDIARFFRGLNIAKGGAALCL---NAQGRRNGEALVRFESEE 277

  Fly   105 DVEEARKLNKASMGHRYIEVFTATPKEAKEAMRKISGHGTA------------FVVKLRGLPYAV 157
            ..:.|.:.:|..||.|||||:.||    .|...||:| ||:            .:|::||||:..
Zfish   278 HRDLALQRHKHHMGGRYIEVYKAT----GEDFLKIAG-GTSNEVASFLSRENQIIVRMRGLPFNA 337

  Fly   158 TEQQIEEFFSGLDIKTD-REGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIF 221
            |.:|:.:|||.....|| .||||||....||.||:|||.|..::..:.||.::::.:|.||||:|
Zfish   338 TAEQVLQFFSPACPVTDGSEGILFVRFPDGRPTGDAFVLFSCEEHAQNALKKHKDMLGKRYIELF 402

  Fly   222 RSSIAEMKR 230
            :|:.||:::
Zfish   403 KSTAAEVQQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 27/73 (37%)
RRM2_hnRNPH_like 146..224 CDD:240948 34/78 (44%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
esrp1XP_005158084.1 DnaQ_like_exo 7..174 CDD:299142
RRM1_ESRP1 221..305 CDD:241180 32/91 (35%)
RRM <272..502 CDD:223796 56/145 (39%)
RRM_SF 310..416 CDD:302621 40/103 (39%)
RRM3_ESRP1_ESRP2 449..529 CDD:241186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.