Sequence 1: | NP_650120.1 | Gene: | glo / 41431 | FlyBaseID: | FBgn0259139 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006237938.1 | Gene: | Esrp1 / 500409 | RGDID: | 1560481 | Length: | 681 | Species: | Rattus norvegicus |
Alignment Length: | 252 | Identity: | 78/252 - (30%) |
---|---|---|---|
Similarity: | 125/252 - (49%) | Gaps: | 57/252 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 DEDDQYNEDGGGKIENVGE--------------------SPKF----------------VRLRGL 56
Fly 57 PWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKASMGHRY 121
Fly 122 IEVFTATPKEAKEAMRKISGHGTA------------FVVKLRGLPYAVTEQQIEEFF-SGLDIKT 173
Fly 174 DREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSSIAEMKR 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
glo | NP_650120.1 | RRM_SF | 51..125 | CDD:302621 | 28/73 (38%) |
RRM2_hnRNPH_like | 146..224 | CDD:240948 | 32/78 (41%) | ||
RRM3_hnRNPH_CRSF1_like | 481..555 | CDD:240950 | |||
Esrp1 | XP_006237938.1 | DnaQ_like_exo | 29..168 | CDD:299142 | 78/252 (31%) |
RRM1_ESRP1 | 221..305 | CDD:241180 | 32/90 (36%) | ||
RRM | <285..473 | CDD:223796 | 51/132 (39%) | ||
RRM2_ESRP1 | 310..418 | CDD:241183 | 38/103 (37%) | ||
RRM3_ESRP1_ESRP2 | 444..524 | CDD:241186 | |||
RRM | <446..>520 | CDD:223796 | |||
RRM_SF | 634..>672 | CDD:302621 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166349084 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
3 | 2.800 |