DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and Esrp1

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006237938.1 Gene:Esrp1 / 500409 RGDID:1560481 Length:681 Species:Rattus norvegicus


Alignment Length:252 Identity:78/252 - (30%)
Similarity:125/252 - (49%) Gaps:57/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DEDDQYNEDGGGKIENVGE--------------------SPKF----------------VRLRGL 56
            :::|..:..|..::|::|.                    :.||                ||.|||
  Rat   168 EKNDSMSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKTELIDGNTVVRARGL 232

  Fly    57 PWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKASMGHRY 121
            ||.::.::|..|.:.:|:..|.|.:.|   ...|:..|||.|...|:|..:.|.:.:|..||.||
  Rat   233 PWQSSDQDIARFFKGLNIAKGGAALCL---NAQGRRNGEALVRFVSEEHRDLALQRHKHHMGTRY 294

  Fly   122 IEVFTATPKEAKEAMRKISGHGTA------------FVVKLRGLPYAVTEQQIEEFF-SGLDIKT 173
            |||:.||    .|...||:| ||:            .:|::||||:..|.:::..|| ....|..
  Rat   295 IEVYKAT----GEDFLKIAG-GTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHCPITG 354

  Fly   174 DREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSSIAEMKR 230
            .:||||||....||.||:|||.|..::..:.||.::::.:|.||||:|||:.||:::
  Rat   355 GKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 28/73 (38%)
RRM2_hnRNPH_like 146..224 CDD:240948 32/78 (41%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
Esrp1XP_006237938.1 DnaQ_like_exo 29..168 CDD:299142 78/252 (31%)
RRM1_ESRP1 221..305 CDD:241180 32/90 (36%)
RRM <285..473 CDD:223796 51/132 (39%)
RRM2_ESRP1 310..418 CDD:241183 38/103 (37%)
RRM3_ESRP1_ESRP2 444..524 CDD:241186
RRM <446..>520 CDD:223796
RRM_SF 634..>672 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.800

Return to query results.
Submit another query.