DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and esrp1

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001005057.1 Gene:esrp1 / 448608 XenbaseID:XB-GENE-985138 Length:687 Species:Xenopus tropicalis


Alignment Length:238 Identity:79/238 - (33%)
Similarity:126/238 - (52%) Gaps:37/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FNYGQQGNGDNFNDDSNQQQDEDDQYNEDGG--GKIENVGESPKFVRLRGLPWSATHKEILDFLE 70
            :||       .|:|      .|...|..:.|  .|:|.:.:: ..:|.|||||.::.::|..|.:
 Frog   197 YNY-------KFSD------PERVNYKFESGTCSKLEIIDDN-TIIRARGLPWQSSDQDIARFFK 247

  Fly    71 NVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKASMGHRYIEVFTATPKEAKEA 135
            .:|:..|.|.:.|   ...|:..|||.|...|:|..:.|.:.:|..||:|||||:.||    .|.
 Frog   248 GLNIAKGGAALCL---NAQGRRNGEALVRFVSEEHRDLALQRHKHHMGNRYIEVYKAT----GED 305

  Fly   136 MRKISGHGTA------------FVVKLRGLPYAVTEQQIEEFF-SGLDIKTDREGILFVMDRRGR 187
            ..||:| ||:            .:|::||||:..|.:::..|| ....:...:||||||.....|
 Frog   306 FLKIAG-GTSNEVAQFLSKENQVIVRMRGLPFTATAEEVLAFFGQQCPVTGGKEGILFVTYPDNR 369

  Fly   188 ATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSSIAEMKR 230
            .||:|||.|..::..:.||.:::|.:|.||||:|||:.||:::
 Frog   370 PTGDAFVLFACEEYAQNALKKHKELLGKRYIELFRSTAAEVQQ 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 27/73 (37%)
RRM2_hnRNPH_like 146..224 CDD:240948 31/78 (40%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
esrp1NP_001005057.1 DnaQ_like_exo 8..>146 CDD:385652
RRM1_ESRP1 222..306 CDD:241180 31/91 (34%)
RRM2_ESRP1 311..419 CDD:241183 37/103 (36%)
RRM3_ESRP1_ESRP2 445..525 CDD:241186
RRM_SF 638..>675 CDD:388407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.