DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and fus

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_524691.1 Gene:fus / 44095 FlyBaseID:FBgn0023441 Length:967 Species:Drosophila melanogaster


Alignment Length:225 Identity:83/225 - (36%)
Similarity:125/225 - (55%) Gaps:26/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EDGGGKIENVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVE 99
            |.|...|::..:....||.|||||.::.::|..|...:||..|  |:.|..|.: |:..|||.:.
  Fly   265 EPGICSIDDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKG--GVALCLSPL-GRRNGEALIR 326

  Fly   100 VASQEDVEEARKLNKASMGHRYIEVFTATPKE--------AKEAMRKISGHGTAFVVKLRGLPYA 156
            ...||..:.|.|.:|..:|.|||||:.|:.::        :.||...:| .|...::::|||||.
  Fly   327 FVCQEHRDMALKRHKHHIGTRYIEVYRASGEDFLAIAGGASNEAQAFLS-KGAQVIIRMRGLPYD 390

  Fly   157 VTEQQIEEFFSGLD-----IKTDREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHR 216
            .|.:|:.:||:..|     :....||:|||....|||||:|||.|.::.|..:||||:||.||.|
  Fly   391 ATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQR 455

  Fly   217 YIEIFRSSIAEMKRATG---------AGGG 237
            |||:|||:.||:::...         :|||
  Fly   456 YIELFRSTTAEVQQVLNRSMDPKNYESGGG 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 29/73 (40%)
RRM2_hnRNPH_like 146..224 CDD:240948 39/82 (48%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
fusNP_524691.1 DnaQ_like_exo 13..194 CDD:299142
RRM1_Fusilli 280..359 CDD:241182 31/81 (38%)
RRM2_Fusilli 363..462 CDD:241185 42/99 (42%)
RRM3_Fusilli 545..629 CDD:241187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4211
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392876at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm959
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13976
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.