DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and RBM12B

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001364889.1 Gene:RBM12B / 389677 HGNCID:32310 Length:1001 Species:Homo sapiens


Alignment Length:236 Identity:59/236 - (25%)
Similarity:94/236 - (39%) Gaps:73/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKA 115
            :||.|||:.|...:|..|...:.:.:|  |:|::     |...|||::..|:.||...|...:..
Human     5 IRLLGLPFIAGPVDIRHFFTGLTIPDG--GVHII-----GGEIGEAFIIFATDEDARRAISRSGG 62

  Fly   116 SMGHRYIEVFTATPKEAKEAM---------RKISGHGTAFV---------VK------------- 149
            .:....:|:|.::..|.::.:         |...|.||:.|         ||             
Human    63 FIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYGSSIN 127

  Fly   150 -------------------------------LRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMD 183
                                           ||||||.|.|..:..|||||.:    :|::|:..
Human   128 QDAGFHTNGTGHGNLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCV----DGVIFLKH 188

  Fly   184 RRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224
            ..||..|:|.|:|.|..|....|..:|..:|.|:||:.:.|
Human   189 HDGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFIEVMQGS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 20/73 (27%)
RRM2_hnRNPH_like 146..224 CDD:240948 32/130 (25%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
RBM12BNP_001364889.1 RRM1_RBM12B 2..80 CDD:410139 22/81 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..147 0/27 (0%)
RRM2_RBM12B 153..238 CDD:410140 30/81 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..278
RRM3_RBM12B 284..363 CDD:409935
RRM4_RBM12B 400..475 CDD:410142
PTZ00121 <449..680 CDD:173412
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 544..587
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 631..882
PHA03321 <689..915 CDD:223041
RRM5_RBM12B 925..1001 CDD:410144
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.