Sequence 1: | NP_650120.1 | Gene: | glo / 41431 | FlyBaseID: | FBgn0259139 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001364889.1 | Gene: | RBM12B / 389677 | HGNCID: | 32310 | Length: | 1001 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 59/236 - (25%) |
---|---|---|---|
Similarity: | 94/236 - (39%) | Gaps: | 73/236 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 VRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKA 115
Fly 116 SMGHRYIEVFTATPKEAKEAM---------RKISGHGTAFV---------VK------------- 149
Fly 150 -------------------------------LRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMD 183
Fly 184 RRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
glo | NP_650120.1 | RRM_SF | 51..125 | CDD:302621 | 20/73 (27%) |
RRM2_hnRNPH_like | 146..224 | CDD:240948 | 32/130 (25%) | ||
RRM3_hnRNPH_CRSF1_like | 481..555 | CDD:240950 | |||
RBM12B | NP_001364889.1 | RRM1_RBM12B | 2..80 | CDD:410139 | 22/81 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 119..147 | 0/27 (0%) | |||
RRM2_RBM12B | 153..238 | CDD:410140 | 30/81 (37%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 247..278 | ||||
RRM3_RBM12B | 284..363 | CDD:409935 | |||
RRM4_RBM12B | 400..475 | CDD:410142 | |||
PTZ00121 | <449..680 | CDD:173412 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 544..587 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 631..882 | ||||
PHA03321 | <689..915 | CDD:223041 | |||
RRM5_RBM12B | 925..1001 | CDD:410144 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165155219 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |