DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and Rbm12b

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006237956.2 Gene:Rbm12b / 313069 RGDID:1307658 Length:843 Species:Rattus norvegicus


Alignment Length:235 Identity:56/235 - (23%)
Similarity:96/235 - (40%) Gaps:72/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKA 115
            :||:|||:.|...:|..|.:.:.:.:|  |:|::     |...|||::..|:.||...|...:..
  Rat     5 IRLQGLPFIAGPVDIRHFFKGLTIPDG--GVHVI-----GGKAGEAFIIFATDEDARRAISRSGG 62

  Fly   116 SMGHRYIEVFTATPKEAKEAM---------------------------------RKISGHGTA-- 145
            .:....:|:|.::..|.::.:                                 .:.||:|:|  
  Rat    63 FIKDSSVELFLSSKVEMQKTIDMKRSARVGRGRPGPEASGVGNMYHFIDALKEEERYSGYGSAVN 127

  Fly   146 ----FVVK----------------------LRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDR 184
                |.:.                      ||||||.|.|..:..|||||.:    :|::.:...
  Rat   128 PDAGFHINGTGLDLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCV----DGVILLKHH 188

  Fly   185 RGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224
            .||..|:|.|:|.|..|....|..:|..:|.|:||:.:.|
  Rat   189 DGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFIEVMQGS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 20/73 (27%)
RRM2_hnRNPH_like 146..224 CDD:240948 29/99 (29%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
Rbm12bXP_006237956.2 RRM_SF 2..80 CDD:418427 22/81 (27%)
RRM2_RBM12B 152..237 CDD:410140 29/81 (36%)
RRM_SF 283..362 CDD:418427
RRM <367..581 CDD:223796
RRM4_RBM12B 401..476 CDD:410142
PTZ00465 <619..703 CDD:185644
RRM_SF 767..843 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.