Sequence 1: | NP_650120.1 | Gene: | glo / 41431 | FlyBaseID: | FBgn0259139 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006237956.2 | Gene: | Rbm12b / 313069 | RGDID: | 1307658 | Length: | 843 | Species: | Rattus norvegicus |
Alignment Length: | 235 | Identity: | 56/235 - (23%) |
---|---|---|---|
Similarity: | 96/235 - (40%) | Gaps: | 72/235 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 VRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKA 115
Fly 116 SMGHRYIEVFTATPKEAKEAM---------------------------------RKISGHGTA-- 145
Fly 146 ----FVVK----------------------LRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDR 184
Fly 185 RGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSS 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
glo | NP_650120.1 | RRM_SF | 51..125 | CDD:302621 | 20/73 (27%) |
RRM2_hnRNPH_like | 146..224 | CDD:240948 | 29/99 (29%) | ||
RRM3_hnRNPH_CRSF1_like | 481..555 | CDD:240950 | |||
Rbm12b | XP_006237956.2 | RRM_SF | 2..80 | CDD:418427 | 22/81 (27%) |
RRM2_RBM12B | 152..237 | CDD:410140 | 29/81 (36%) | ||
RRM_SF | 283..362 | CDD:418427 | |||
RRM | <367..581 | CDD:223796 | |||
RRM4_RBM12B | 401..476 | CDD:410142 | |||
PTZ00465 | <619..703 | CDD:185644 | |||
RRM_SF | 767..843 | CDD:418427 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166349098 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |