DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glo and sym-2

DIOPT Version :9

Sequence 1:NP_650120.1 Gene:glo / 41431 FlyBaseID:FBgn0259139 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_495960.2 Gene:sym-2 / 174461 WormBaseID:WBGene00006367 Length:618 Species:Caenorhabditis elegans


Alignment Length:210 Identity:81/210 - (38%)
Similarity:121/210 - (57%) Gaps:25/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EDDQYNEDGGGKIENVGESPKFVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNT 93
            ||.:...||    :||     ..|.|||||.|:...:..|...:::..|  ||.|..|. :|:..
 Worm   170 EDQEVGADG----DNV-----VCRARGLPWQASDHHVAQFFAGLDIVPG--GIALCLSS-EGRRN 222

  Fly    94 GEAYVEVASQEDVEEARKLNKASMGHRYIEVFTATPKE--------AKEAMRKISGHGTAFVVKL 150
            ||..|:.:|||..:.|.|.::..:..|||||:.|...|        :.|||..:|.:  |.:|::
 Worm   223 GEVLVQFSSQESRDLALKRHRNFLLSRYIEVYKAGLDEFMHVATGSSTEAMEFVSAN--AIIVRM 285

  Fly   151 RGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDRRGRATGEAFVQFESQDDTEQALGRNREKIGH 215
            |||||..|:.||..||..|.: ||:  |||:....||.||:||||||:::|.:|.|.::|:.||.
 Worm   286 RGLPYDCTDAQIRTFFEPLKL-TDK--ILFITRTDGRPTGDAFVQFETEEDAQQGLLKHRQVIGQ 347

  Fly   216 RYIEIFRSSIAEMKR 230
            ||||:|:|:.||:::
 Worm   348 RYIELFKSTAAEVQQ 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gloNP_650120.1 RRM_SF 51..125 CDD:302621 26/73 (36%)
RRM2_hnRNPH_like 146..224 CDD:240948 38/77 (49%)
RRM3_hnRNPH_CRSF1_like 481..555 CDD:240950
sym-2NP_495960.2 RRM1_ESRPs_Fusilli 182..256 CDD:240951 27/76 (36%)
RRM2_ESRPs_Fusilli 281..355 CDD:240952 38/76 (50%)
RRM <282..446 CDD:223796 41/84 (49%)
RRM3_Fusilli 388..472 CDD:241187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I6431
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.