DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbf and MTMR4

DIOPT Version :9

Sequence 1:NP_477401.2 Gene:Sbf / 41427 FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:NP_001364996.1 Gene:MTMR4 / 9110 HGNCID:7452 Length:1209 Species:Homo sapiens


Alignment Length:722 Identity:182/722 - (25%)
Similarity:283/722 - (39%) Gaps:171/722 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1168 RLGFDAESQRGFRISNANTSYATCRSYPAIIVAPVQCSDAAIMHLGRCFKGQRIPLPTWRH-ANG 1231
            |:|||.  |..:|:|:.|::|..|.|||..::.||..:|..:.::......:|||:..:|| .||
Human   179 RMGFDL--QNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNG 241

  Fly  1232 ALLIRGGQPNSKSVIGMLKNTTGSTTNAHHDVTHYPEQDKYFLALINTMPKLTPLALNQYSGMNL 1296
            |.:.|..||         :.:.....||         .|:|.:..|.....|.|       |...
Human   242 AAIARCSQP---------EISWWGWRNA---------DDEYLVTSIAKACALDP-------GTRA 281

  Fly  1297 SMSSLMGHSSSDDRQPLTPELSRKHKNNLDISDGNKSSQGGKGGTMKGNPKNSLAHPFRKMRLYA 1361
            :     |.|.|......:........::|....|.:|:..         |:..|   ....|.|.
Human   282 T-----GGSLSTGNNDTSEACDADFDSSLTACSGVESTAA---------PQKLL---ILDARSYT 329

  Fly  1362 LGEKSQAKSNMNVDFCADFIP------VDYPDIRQSRPAFKKLIRAC--MPSHNTNEADGQSFAK 1418
            ....::||.....  |.::.|      :...:|...|.:|:.|...|  ||       |..::..
Human   330 AAVANRAKGGGCE--CEEYYPNCEVVFMGMANIHAIRNSFQYLRAVCSQMP-------DPSNWLS 385

  Fly  1419 MVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLCLDPYYRSLDGFR 1483
            .:|.:.|||.:|.:::.:..|.:.:|.:...|::...||.|.|.|:.::|::.||||||:|:||:
Human   386 ALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVALAKILLDPYYRTLEGFQ 450

  Fly  1484 VLVEKEWLAFGHRF----AHRSNLKPSHANTNIAFAPTFLQFLDVVHQLQRQFPMAFEFNDFYLR 1544
            ||||.:||.|||:|    .|:.|::..:..     .|.|||:||.||||.:|||..||||:.:|.
Human   451 VLVESDWLDFGHKFGDRCGHQENVEDQNEQ-----CPVFLQWLDSVHQLLKQFPCLFEFNEAFLV 510

  Fly  1545 FLAYHSVSCRFRTFLFDCELERSDSGIAAMEDKRGSLNAKHMFGAGGMATNGSDDECSVYPLDIR 1609
            .|..|:.||.:.|||.:...||....|.    ||                     .|||:.|   
Human   511 KLVQHTYSCLYGTFLANNPCEREKRNIY----KR---------------------TCSVWAL--- 547

  Fly  1610 SQRAPAPLNRIGHSIFDYIERQHNKTPIFYNFLYSGDKSVTLRPQNNVAALDLWCYYTNEELAQG 1674
                               .|..||.  |:||||:....:.|.|..:|.||.||   |...|...
Human   548 -------------------LRAGNKN--FHNFLYTPSSDMVLHPVCHVRALHLW---TAVYLPAS 588

  Fly  1675 AP-------YDLEVTTVDDEIDLSETKGKRMVITAGYDN-MEKCNPSAYVCLLSEVKQAETERGH 1731
            :|       .||.::.|....:.|.....|:..|...|: :..|:.|:   .|:..........|
Human   589 SPCTLGEENMDLYLSPVAQSQEFSGRSLDRLPKTRSMDDLLSACDTSS---PLTRTSSDPNLNNH 650

  Fly  1732 LPQ--KWLQVWNSLEVPQLEPVARNTSLGNIFVQTHQHKRSTLEIIMKGRLAGYQDKYFHPHRFE 1794
            ..:  ..|:.|:|      .|....||..:..|...|  ::..|:.:...|...|..|.....|:
Human   651 CQEVRVGLEPWHS------NPEGSETSFVDSGVGGPQ--QTVGEVGLPPPLPSSQKDYLSNKPFK 707

  Fly  1795 KHPYTTPTNCNHCTKLLWGPVGYRCMDCGNSYHEKCTEHSMKNCT---KYKAIDGAVGP---PNV 1853
            .|     .:|:...|||                .......||:.|   :.|.::...||   |:.
Human   708 SH-----KSCSPSYKLL----------------NTAVPREMKSNTSDPEIKVLEETKGPAPDPSA 751

  Fly  1854 NMSQGDT 1860
            ....|.|
Human   752 QDELGRT 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396
Myotub-related 1161..1565 CDD:284109 117/409 (29%)
C1 1791..1838 CDD:237996 8/46 (17%)
PH_Sbf1_hMTMR5 1888..1993 CDD:269941
PH 1891..1992 CDD:278594
MTMR4NP_001364996.1 PH-GRAM_MTMR4 37..150 CDD:270150
PTP-MTMR4 186..493 CDD:350435 94/362 (26%)
FYVE_MTMR4 1125..1184 CDD:277272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.