DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbf and MTMR6

DIOPT Version :9

Sequence 1:NP_477401.2 Gene:Sbf / 41427 FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:NP_001372159.1 Gene:MTMR6 / 9107 HGNCID:7453 Length:659 Species:Homo sapiens


Alignment Length:761 Identity:170/761 - (22%)
Similarity:282/761 - (37%) Gaps:229/761 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   961 GALFLTNYRVIFKGSPCDPLFCEQVIVRTFPIASLLKEKKISVLYLAHLDQTLTEGLQLRSSSFQ 1025
            |.|:||...::|                   |.|..||     .::.|......|.|.|.:|...
Human    27 GTLYLTATHLLF-------------------IDSHQKE-----TWILHHHIASVEKLALTTSGCP 67

  Fly  1026 LIKVAFDPEVTPEQIESFRKILSKARHPFDEFEYFAFQSYGTMLQGVAPLKTKEKYSTLKGFAKK 1090
            |:          .|.::||.:     |.....|......|.::||    |..:.||..|..|:  
Human    68 LV----------IQCKNFRTV-----HFIVPRERDCHDIYNSLLQ----LSKQAKYEDLYAFS-- 111

  Fly  1091 TLLRGAKKAGFKQKQQTKRKLVSDYDYGSADAQETQSIDDELEDGDEFETQNNAMPRLLTTKDVE 1155
                      :..||....:|           |..|.||                          
Human   112 ----------YNPKQNDSERL-----------QGWQLID-------------------------- 129

  Fly  1156 RMRERSYVQDWKRLGFDAESQRGFRISNANTSYATCRSYPAIIVAPVQCSDAAIMHLGRCFKGQR 1220
                  ..:::||:|.   ....:::|:||..|..|.:||..:..|...|...|:...:.....|
Human   130 ------LAEEYKRMGV---PNSHWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKFRSKGR 185

  Fly  1221 IPLPTWRHAN-GALLIRGGQPNSKSVIGMLKNTTGSTTNAHHDVTHYPEQDKYFLALINTMPKLT 1284
            .|:.::.|.: .|.:.|..||.|......|                   :|::.|..|:   |..
Human   186 FPVLSYYHQDKEAAICRCSQPLSGFSARCL-------------------EDEHLLQAIS---KAN 228

  Fly  1285 PLALNQY-----SGMNLSMSSLMGHSSSDDRQPLTPELSRKHKNNLDISDGNKSSQGGKGGTMKG 1344
            |  :|:|     :.....|.|..  ::..|...:...:|.|.:|:..|.:.|:            
Human   229 P--VNRYMYVMDTRPKRRMQSWW--ATQKDIGRIIVRISSKIQNDEKIRESNE------------ 277

  Fly  1345 NPKNSLAHPFRKMRLYALGEKSQAKSNMNVDFCAD----FIPVDYPDIRQSRPAFKKLIRACMPS 1405
                       |.||.|:..::..|...|.|..::    |:.::  :|...|.:.:||:..    
Human   278 -----------KKRLNAMANRAAGKGYENEDNYSNIRFQFVGIE--NIHVMRSSLQKLLEV---- 325

  Fly  1406 HNTNEADGQSFAKMVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQL 1470
            :.|.......|...:|.|.||:.|.::|..:..:...|.::.:||::...||.|.|:|:.|:..|
Human   326 NGTKGLSVNDFYSGLESSGWLRHIKAVMDAAIFLAKAITVENASVLVHCSDGWDRTSQVCSLGSL 390

  Fly  1471 CLDPYYRSLDGFRVLVEKEWLAFGHRFAHRSNL---KPSHANTNIAFAPTFLQFLDVVHQLQRQF 1532
            .||.|||::.||.||:||:|::|||:|:.|...   .|...      :|.|.|||:.|..|..||
Human   391 LLDSYYRTIKGFMVLIEKDWISFGHKFSERCGQLDGDPKEV------SPVFTQFLECVWHLTEQF 449

  Fly  1533 PMAFEFNDFYLRFLAYHSVSCRFRTFLFDCELERSDSGIAAMEDKRGSLNAKHMFGAGGMATNGS 1597
            |.||||::.:|..:..|..||:|..||.:|:.||.:   ..:::|..||                
Human   450 PQAFEFSEAFLLQIHEHIHSCQFGNFLGNCQKEREE---LKLKEKTYSL---------------- 495

  Fly  1598 DDECSVYPLDIRSQRAPAPLNRIGHSIFDYIERQHNKT-----PIFYNF------LYSGDKSVTL 1651
                  :|..:..|:  ..||.:      |....|..|     .:.:||      .:..|:  ||
Human   496 ------WPFLLEDQK--KYLNPL------YSSESHRFTVLEPNTVSFNFKFWRNMYHQFDR--TL 544

  Fly  1652 RPQNNVAALDLWCYYTNEELAQGAPYDLEVTTVDDEIDLSETKGKR 1697
            .|:.:|..:.:   ..||:..|     ||....|.|..:.:.|.|:
Human   545 HPRQSVFNIIM---NMNEQNKQ-----LEKDIKDLESKIKQRKNKQ 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 18/85 (21%)
Myotub-related 1161..1565 CDD:284109 107/416 (26%)
C1 1791..1838 CDD:237996
PH_Sbf1_hMTMR5 1888..1993 CDD:269941
PH 1891..1992 CDD:278594
MTMR6NP_001372159.1 PH-GRAM_MTMR6 1..101 CDD:270151 24/116 (21%)
PTP_DSP_cys 130..469 CDD:421693 101/402 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.