DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbf and MTMR9

DIOPT Version :9

Sequence 1:NP_477401.2 Gene:Sbf / 41427 FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:NP_056273.2 Gene:MTMR9 / 66036 HGNCID:14596 Length:549 Species:Homo sapiens


Alignment Length:446 Identity:115/446 - (25%)
Similarity:180/446 - (40%) Gaps:131/446 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1132 LEDG-------DEFETQNNAMPRLLTTKDVERMRERSYVQDWKRLGFDAESQRGFRISNANTSYA 1189
            :|||       .|||..::|                  ..:|             |:|..|..:|
Human   120 IEDGWHSFLPEQEFELYSSA------------------TSEW-------------RLSYVNKEFA 153

  Fly  1190 TCRSYPAIIVAPVQCSDAAIMHLGRCFKGQRIPLPTWRH-ANGALLIRGGQPNSKSVIGMLKNTT 1253
            .|.|||.|:..|....|.|:..:.....|.|.|:.::.| .||.:::|.|||        |..|.
Human   154 VCPSYPPIVTVPKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQP--------LTGTN 210

  Fly  1254 GSTTNAHHDVTHYPEQDKYFLALINTMPKLTPLALNQYSGMNLSMSSLMGHSSSDDRQPLTPELS 1318
            |....         |.:|    |||...:                                   :
Human   211 GRRCK---------EDEK----LINATLR-----------------------------------A 227

  Fly  1319 RKHKNNLDISDGNKSSQ-GGKGGTMKGNPKNSLAHPFRKMRLYALGEKSQAKSNMNVDFCADFIP 1382
            .|....:|....|.:.| ..|||..:..     ||..:..|::...|:                 
Human   228 GKRGYIIDTRSLNVAQQTRAKGGGFEQE-----AHYPQWRRIHKSIER----------------- 270

  Fly  1383 VDYPDIRQSRPAFKKLIRACM-PSHNTNEADGQSFAKMVEQSDWLQQISSLMQLSGAVVDLIDLQ 1446
              |..:::|   ..||:.||. .:||.:.     :...:|.|:||..|..::..:......||.:
Human   271 --YHILQES---LIKLVEACNDQTHNMDR-----WLSKLEASNWLTHIKEILTTACLAAQCIDRE 325

  Fly  1447 ESSVMLSLEDGSDVTAQLSSIAQLCLDPYYRSLDGFRVLVEKEWLAFGHRFAHRSNLKPSHANTN 1511
            .:|:::...:|:|.|.|::|:||:.|:|..|::.||..|:|:|||..||.|..|. .:.::.||.
Human   326 GASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRGFEALIEREWLQAGHPFQQRC-AQSAYCNTK 389

  Fly  1512 IAF-APTFLQFLDVVHQLQRQFPMAFEFNDFYLRFLAYHSVSCRFRTFLFDCELER 1566
            ..: ||.||.|||.|.|:.||||.:||||:.:|..|..|:.:.:|.|||.:.|.||
Human   390 QKWEAPVFLLFLDCVWQILRQFPCSFEFNENFLIMLFEHAYASQFGTFLGNNESER 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396
Myotub-related 1161..1565 CDD:284109 106/407 (26%)
C1 1791..1838 CDD:237996
PH_Sbf1_hMTMR5 1888..1993 CDD:269941
PH 1891..1992 CDD:278594
MTMR9NP_056273.2 PH-GRAM_MTMR9 1..97 CDD:275398
Myotub-related 127..446 CDD:310891 112/439 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.