DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbf and MTMR10

DIOPT Version :9

Sequence 1:NP_477401.2 Gene:Sbf / 41427 FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:NP_060232.2 Gene:MTMR10 / 54893 HGNCID:25999 Length:777 Species:Homo sapiens


Alignment Length:676 Identity:151/676 - (22%)
Similarity:252/676 - (37%) Gaps:222/676 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   921 KPKIQ--TPCLLPGEDLVTD---HLRCFLMPDGREDETQCLIPAEGAL-FLT---------NYRV 970
            :|||:  .|.|||||.:|.:   ..:|......:.|....||.:...: |:|         :||.
Human    28 EPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTSQYDLWGKLICSNFKISFITDDPMPLQKFHYRN 92

  Fly   971 IFKGSPCDPLFC-EQVIVRTFPIASLLKEKKISVLYLAHLDQTL----TEGLQLRSSSFQLIKVA 1030
            :..|....||.| ||::.    :....:::|:     ...:|.|    || |.:....|::::..
Human    93 LLLGEHDVPLTCIEQIVT----VNDHKRKQKV-----LGPNQKLKFNPTE-LIIYCKDFRIVRFR 147

  Fly  1031 FDPEVTPEQIESFRKILSKARHPFDEFEYFAFQSYGTMLQGVAPLKTKEKY----STLKGFAKKT 1091
            || |..||..:.....::....|.|....|||:..|            :||    :.:.|.....
Human   148 FD-ESGPESAKKVCLAIAHYSQPTDLQLLFAFEYVG------------KKYHNSANKINGIPSGD 199

  Fly  1092 LLRGAKKAGFKQKQQTKRKLVSDYDYGSADAQETQSIDDELEDGDEFETQNNAMPRLLTTKDVER 1156
               |....|            .....|...:|:|..          |||.:              
Human   200 ---GGGGGG------------GGNGAGGGSSQKTPL----------FETYS-------------- 225

  Fly  1157 MRERSYVQDWKRLGFDAESQR----GFRISNANTSYATCRSYPAIIVAPVQCSDAAIMHLGRCFK 1217
                    ||     |.|.:|    |:|:.:.|..|......|..||.|...:|..:......|.
Human   226 --------DW-----DREIKRTGASGWRVCSINEGYMISTCLPEYIVVPSSLADQDLKIFSHSFV 277

  Fly  1218 GQRIPLPTWRHANGALLIRGGQPNSKSVIGMLKNTTGSTTNAHHDVTHYPEQDKYFLALINTMPK 1282
            |:|:||..|.|:||:.|:|         :.::|:..              :|.|....:.|.:.|
Human   278 GRRMPLWCWSHSNGSALVR---------MALIKDVL--------------QQRKIDQRICNAITK 319

  Fly  1283 LTPLALNQYSGMNLSMSSLMGHSSSDDRQPLTPELSRKHKNNLDISDGNKSSQGGKGGTMKGNPK 1347
                                .|          |:.|..:|::||.:                   
Human   320 --------------------SH----------PQRSDVYKSDLDKT------------------- 335

  Fly  1348 NSLAHPFRKMRLYALGEKSQAKSNMNVDFCADFIPVDYPDIRQSRPAFKKLIRACM--PSHNTNE 1410
                                                 .|:|::.:.||.||.:.|:  |...|.|
Human   336 -------------------------------------LPNIQEVQAAFVKLKQLCVNEPFEETEE 363

  Fly  1411 ADGQSFAKMVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLCLDPY 1475
                .:...:|.:.||:.:.:.::.|..:|.:::.:..||:|..|:|.|::..::|:.|:.||||
Human   364 ----KWLSSLENTRWLEYVRAFLKHSAELVYMLESKHLSVVLQEEEGRDLSCCVASLVQVMLDPY 424

  Fly  1476 YRSLDGFRVLVEKEWLAFGHRFAHRSNLKPSHANTNIAFAPTFLQFLDVVHQLQRQFPMAFEFND 1540
            :|::.||:.|::|||:..|::|..|.|    |...:...:|.||.|||...||..|:|.||||::
Human   425 FRTITGFQSLIQKEWVMAGYQFLDRCN----HLKRSEKESPLFLLFLDATWQLLEQYPAAFEFSE 485

  Fly  1541 FYLRFLAYHSVSCRFRTFLFDCELER 1566
            .||..|...:....|.||||:...:|
Human   486 TYLAVLYDSTRISLFGTFLFNSPHQR 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 28/131 (21%)
Myotub-related 1161..1565 CDD:284109 97/409 (24%)
C1 1791..1838 CDD:237996
PH_Sbf1_hMTMR5 1888..1993 CDD:269941
PH 1891..1992 CDD:278594
MTMR10NP_060232.2 PH-GRAM_MTMR10 21..195 CDD:270154 44/189 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..217 3/35 (9%)
Myotub-related 226..507 CDD:284109 97/402 (24%)
3-PAP 578..705 CDD:289355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.