DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbf and MTMR12

DIOPT Version :9

Sequence 1:NP_477401.2 Gene:Sbf / 41427 FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster
Sequence 2:NP_001035536.1 Gene:MTMR12 / 54545 HGNCID:18191 Length:747 Species:Homo sapiens


Alignment Length:742 Identity:137/742 - (18%)
Similarity:245/742 - (33%) Gaps:272/742 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   929 LLPGEDLVTDHLRCFLMPDGREDETQCLIPAEGALFLTNYRVIFKGSPCDPLFCEQVIVRTFPIA 993
            |||||.|:.:  ...::...:||  .|.....|.|..|::::.|.|.                  
Human    45 LLPGEQLLCE--ASTVLKYVQED--SCQHGVYGRLVCTDFKIAFLGD------------------ 87

  Fly   994 SLLKEKKISVLYLAHLDQTLTEGLQLRSSSFQLIKVAFDPEVTPEQIESFRKILSKARHPFDEFE 1058
                            |::..:..:.:..:    ||..:.::|              .|..|:  
Human    88 ----------------DESALDNDETQFKN----KVIGENDIT--------------LHCVDQ-- 116

  Fly  1059 YFAFQSYGTMLQGVAPLKTKEKYSTLKGFAKKTLLRGAKKAGFK-----QKQQTKRKLVSD---- 1114
                      :.||...|.|..:..||.:.:|.::.......|:     .|::..:::||.    
Human   117 ----------IYGVFDEKKKTLFGQLKKYPEKLIIHCKDLRVFQFCLRYTKEEEVKRIVSGIIHH 171

  Fly  1115 ----------YDYGSADAQETQSIDDELEDGDEFETQNNAMPRLLTTKDVERMRERSYVQDWKRL 1169
                      :.:..|.|.:..::.|.......|:|                      ::||   
Human   172 TQAPKLLKRLFLFSYATAAQNNTVTDPKNHTVMFDT----------------------LKDW--- 211

  Fly  1170 GFDAESQRG---FRISNANTSYATCRSYPAIIVAPVQCSDAAIMHLGRCFKGQRIPLPTWRHANG 1231
            .::.|..:|   ::..:.|..|..|...||..|.|....:..:..    |:|..||:..|...||
Human   212 CWELERTKGNMKYKAVSVNEGYKVCERLPAYFVVPTPLPEENVQR----FQGHGIPIWCWSCHNG 272

  Fly  1232 ALLIRGGQPNSKSVIGMLKNTTGSTTNAHHDVTHYPEQDKYFLALINTMPKLTPLALNQYSG-MN 1295
            :.|::                                        ::.:||      .|..| :.
Human   273 SALLK----------------------------------------MSALPK------EQDDGILQ 291

  Fly  1296 LSMSSLMGHSSSDDRQPLTPELSRKHKNNLDISDGNKSSQGGKGGTMKGNPKNSLAHPFRKMRLY 1360
            :..|.|.|...:..|.|                                               |
Human   292 IQKSFLDGIYKTIHRPP-----------------------------------------------Y 309

  Fly  1361 ALGEKSQAKSNMNVDFCADFIPVDYPDIRQSRPAFKKLIRACMPSHNTN--EADGQSFAKMVEQS 1423
            .:.:.....||             :..:::.:.|:.|..:..:..::|.  :.|.:.|: ::|.|
Human   310 EIVKTEDLSSN-------------FLSLQEIQTAYSKFKQLFLIDNSTEFWDTDIKWFS-LLESS 360

  Fly  1424 DWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLCLDPYYRSLDGFRVLVEK 1488
            .||..|...::.:..:.:.::.|..:|:|..|:.||:...:||:.||.:||:.|:..||:.|::|
Human   361 SWLDIIRRCLKKAIEITECMEAQNMNVLLLEENASDLCCLISSLVQLMMDPHCRTRIGFQSLIQK 425

  Fly  1489 EWLAFGHRFAHRSNLKPSHANTN-IAFAPTFLQFLDVVHQLQRQFPMAFEFNDFYLRFLAYHSVS 1552
            ||:..||.|..|.|    |...| ....|.||.|||.|.||..|.|.||||.:.||..|:.....
Human   426 EWVMGGHCFLDRCN----HLRQNDKEEVPVFLLFLDCVWQLVHQHPPAFEFTETYLTVLSDSLYI 486

  Fly  1553 CRFRTFLFDCELERSDSGIAAMEDKRGSLNAKHMFGAGGMATNGSDDECSVYPLDIRSQRAPAPL 1617
            ..|.||.|                     |:.|.... .|...|.|.:..             ||
Human   487 PIFSTFFF---------------------NSPHQKDT-NMGREGQDTQSK-------------PL 516

  Fly  1618 NRIGHSIFDY-IERQHNKTPIFYNFLY 1643
            |.:  :::|: ::.:.....:..|.||
Human   517 NLL--TVWDWSVQFEPKAQTLLKNPLY 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396 14/113 (12%)
Myotub-related 1161..1565 CDD:284109 89/410 (22%)
C1 1791..1838 CDD:237996
PH_Sbf1_hMTMR5 1888..1993 CDD:269941
PH 1891..1992 CDD:278594
MTMR12NP_001035536.1 PH-like 26..202 CDD:327399 34/224 (15%)
PTPc 228..496 CDD:328744 85/403 (21%)
Interaction with MTM1. /evidence=ECO:0000269|PubMed:12847286 449..558 34/130 (26%)
3-PAP 563..686 CDD:315286
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.