DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisCl1 and srsx-31

DIOPT Version :9

Sequence 1:NP_731632.1 Gene:HisCl1 / 41426 FlyBaseID:FBgn0037950 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001023767.1 Gene:srsx-31 / 3565162 WormBaseID:WBGene00008552 Length:308 Species:Caenorhabditis elegans


Alignment Length:168 Identity:37/168 - (22%)
Similarity:71/168 - (42%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 IEYSTGNFTCLAIVFNLRRRLGYHLFHTYIPSALIVVMSWISFWI----------------KPEA 291
            |:|:| ...|:|.:...|:..||..:.:.|.:..||::...::::                |..|
 Worm   147 IDYNT-QIICMAPLALPRQAFGYFTYSSNIINVKIVIVYAYTYFVLRGYKERDANRMRYVFKSIA 210

  Fly   292 IPARVTL-GVTSLL---TLATQNTQSQQSLPPVSYVKAIDVWMS-SCSVFVFLSL-MEF-AVVNN 349
            :...|.| |.|::.   |:|....:.:.:...:|......|.:| |.:|.||.:: .|: :.:..
 Worm   211 LTVIVVLIGWTTVTIGNTIALGVIEDRHTSEIISIHAGFGVNISCSINVIVFYAINSEYRSAIRR 275

  Fly   350 FMGPVATKAMKGYSDENISDLDDLKSALQHHRESIIEP 387
            ..|      ||.:|    ||:.....::...|.||:.|
 Worm   276 LFG------MKIHS----SDVSKSDPSVITKRISIVSP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisCl1NP_731632.1 Neur_chan_LBD 67..262 CDD:280998 6/18 (33%)
Neur_chan_memb 270..>350 CDD:280999 19/102 (19%)
srsx-31NP_001023767.1 TM helix 1 11..36 CDD:341315
7TM_GPCR_Srsx 19..277 CDD:255903 27/130 (21%)
TM helix 2 43..67 CDD:341315
TM helix 3 79..109 CDD:341315
TM helix 4 122..140 CDD:341315
TM helix 5 165..190 CDD:341315 5/24 (21%)
TM helix 6 201..230 CDD:341315 7/28 (25%)
TM helix 7 241..266 CDD:341315 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.