DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisCl1 and GABRA3

DIOPT Version :9

Sequence 1:NP_731632.1 Gene:HisCl1 / 41426 FlyBaseID:FBgn0037950 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_000799.1 Gene:GABRA3 / 2556 HGNCID:4077 Length:492 Species:Homo sapiens


Alignment Length:415 Identity:126/415 - (30%)
Similarity:192/415 - (46%) Gaps:68/415 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YDKNRAPKLLGQPTVVYFHVTVLSLDSINEESMTYVTDIFLAQSWRDPRLRLPENMSEQYRILDV 131
            ||....|.|....|.|...:.|.|...:::..|.|..|:|..|:|.|.||:....|    :||.:
Human    78 YDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPM----KILPL 138

  Fly   132 DWL--HSIWRPDCFFKNAKKVTFHEMSIPNHYLWLYHDKTLLYMSKLTLVLSCAMKFESYPHDTQ 194
            :.|  ..||.||.||.|.||...|.|:.||..|.|..:.||||..:||:...|.|..|.:|.|..
Human   139 NNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMRLTIHAECPMHLEDFPMDVH 203

  Fly   195 ICSMMIESLSHTVEDLVFIWNMTDPLVVNTEIE-------LPQLDISNNYTTDCTIEYSTGNFTC 252
            .|.:...|.::|..::|:.|.    |..|..:|       |.|.|:..:......|..|||.:..
Human   204 ACPLKFGSYAYTTAEVVYSWT----LGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVV 264

  Fly   253 LAIVFNLRRRLGYHLFHTYIPSALIVVMSWISFWIKPEAIPARVTLGVTSLLTLATQNTQSQQSL 317
            :...|:|:|::||.:..||:|..:.|::|.:|||:..|::|||...|||::||:.|.:..::.||
Human   265 MTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSL 329

  Fly   318 PPVSYVKAIDVWMSSCSVFVFLSLMEFAVVNNFMGPVATKAMKGYSDENISDLDDLKS---ALQH 379
            |.|:|..|:|.:::.|..|||.:|:|||.||.|     ||....:..:.:.:..::|.   |...
Human   330 PKVAYATAMDWFIAVCYAFVFSALIEFATVNYF-----TKRSWAWEGKKVPEALEMKKKTPAAPA 389

  Fly   380 HRESII--------------EPQYDTFCHGHA------------------------TAIY----- 401
            .:.|..              :.::.|...|.|                        |..|     
Human   390 KKTSTTFNIVGTTYPINLAKDTEFSTISKGAAPSASSTPTIIASPKATYVQDSPTETKTYNSVSK 454

  Fly   402 IDKFSRFFFPFSFFILNIVYWTTFL 426
            :||.||..||..|.|.|:|||.|::
Human   455 VDKISRIIFPVLFAIFNLVYWATYV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisCl1NP_731632.1 Neur_chan_LBD 67..262 CDD:280998 64/203 (32%)
Neur_chan_memb 270..>350 CDD:280999 35/79 (44%)
GABRA3NP_000799.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..54
LIC 69..478 CDD:273305 125/412 (30%)
LGIC_ECD_GABAAR_A3 75..274 CDD:349837 64/203 (32%)
Cys-loop 191..205 CDD:349837 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.