DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisCl1 and Gabrp

DIOPT Version :9

Sequence 1:NP_731632.1 Gene:HisCl1 / 41426 FlyBaseID:FBgn0037950 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_666129.1 Gene:Gabrp / 216643 MGIID:2387597 Length:440 Species:Mus musculus


Alignment Length:434 Identity:128/434 - (29%)
Similarity:208/434 - (47%) Gaps:55/434 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CVHGYRNNTESAELVSHYESSLSLPDILPIPSKTYDKNRAPKLLGQPTVVYFHVTVLSLDSINEE 97
            |:.|.:.|.|.:.     ...||||....: :..|:|...|...|.|..:...:.:.|:.||:|.
Mouse    20 CIQGNQVNVEVSR-----SDKLSLPGFENL-TAGYNKFLRPNFGGDPVRIALTLDIASISSISES 78

  Fly    98 SMTYVTDIFLAQSWRDPRLRLPENMSEQYRILDVDWLHSIWRPDCFFKNAKKVTFHEMSIPNHYL 162
            :|.|...|:|.|.|.||||....|.|   ..||...:..:|.||.:...:||...||:::.|..:
Mouse    79 NMDYTATIYLRQRWTDPRLVFEGNKS---FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLI 140

  Fly   163 WLYHDKTLLYMSKLTLVLSCAMKFESYPHDTQICSMMIESLSHTVEDLVFIWNMTDPLVVNTE-I 226
            .|:.:.|:||..::|..::|.|....||.|||.|.:.:||..:...|:.|.|...:..|...| :
Mouse   141 RLFSNGTVLYALRITTTVTCNMDLSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENL 205

  Fly   227 ELPQLDISNNYTTDCTIEYSTGNFTCLAIVFNLRRRLGYHLFHTYIPSALIVVMSWISFWIKPEA 291
            .|.|..|...:|.....:..|||:|.|.:.|.|||.:.|.:..||:||..:||:||:||||..::
Mouse   206 RLAQYTIQQYFTLVTVSQQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDS 270

  Fly   292 IPARVTLGVTSLLTLATQNTQSQQSLPPVS-YVKAIDVWMSSCSVFVFLSLMEFAV--------- 346
            :|||..:|||::|::.|....|:.|||..: ::|||||::..|..|||.:|:|:||         
Mouse   271 VPARTCIGVTTVLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQM 335

  Fly   347 -----------------------VNNFMGPVATKAMK------GYSDENISDLDDLKSALQHHRE 382
                                   :::|...::..:::      .|||..:...|..|...:....
Mouse   336 AVKDRGPAKDSEEVNITNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKIS 400

  Fly   383 SIIEPQYDTFCHGHATAIYIDKFSRFFFPFSFFILNIVYWTTFL 426
            .||:  |.|.    .....:|::|:..||..|.:.|:.||..::
Mouse   401 RIID--YFTI----QNPSNVDRYSKLLFPLIFMLANVFYWAYYM 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisCl1NP_731632.1 Neur_chan_LBD 67..262 CDD:280998 63/195 (32%)
Neur_chan_memb 270..>350 CDD:280999 37/112 (33%)
GabrpNP_666129.1 Neur_chan_LBD 41..242 CDD:280998 64/204 (31%)
LIC 43..437 CDD:273305 120/403 (30%)
Neur_chan_memb 249..434 CDD:280999 53/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.