DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and IDD7

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001322628.1 Gene:IDD7 / 841954 AraportID:AT1G55110 Length:455 Species:Arabidopsis thaliana


Alignment Length:228 Identity:49/228 - (21%)
Similarity:79/228 - (34%) Gaps:90/228 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 HMTNMTDANG--AALTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTNASGGTGTASGKKTKKK 276
            :|:|:|.|:|  |::::|         |.|.|:|        .::...:........|..|.|:.
plant    20 NMSNLTSASGDQASVSSG---------NRTETSG--------SNINQHHQEQCFVPQSSLKRKRN 67

  Fly   277 KPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALK 341
            :|   ..|.|:    .|..||...||       ||                ..||:|::||...:
plant    68 QP---GNPDPE----AEVMALSPKTL-------MA----------------TNRFICEVCNKGFQ 102

  Fly   342 RKDHLTRHKLSH--------------IPDRPHVCNI--CM---------------KSFKRKEQLT 375
            |..:|..||..|              :..:.:||..  |:               |.|.||.   
plant   103 RDQNLQLHKRGHNLPWKLKQRSNKDVVRKKVYVCPEPGCVHHHPSRALGDLTGIKKHFFRKH--- 164

  Fly   376 LHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRS 408
                   ||||..|.:|.|.:..:...:.|.::
plant   165 -------GEKKWKCEKCSKKYAVQSDWKAHAKT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 2/19 (11%)
zf-C2H2_8 306..391 CDD:292531 24/115 (21%)
C2H2 Zn finger 333..353 CDD:275368 7/19 (37%)
zf-H2C2_2 345..370 CDD:290200 9/55 (16%)
C2H2 Zn finger 361..381 CDD:275368 6/36 (17%)
zf-H2C2_2 374..398 CDD:290200 7/23 (30%)
C2H2 Zn finger 389..409 CDD:275368 4/20 (20%)
IDD7NP_001322628.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.