DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and NUC

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_199229.1 Gene:NUC / 834439 AraportID:AT5G44160 Length:466 Species:Arabidopsis thaliana


Alignment Length:205 Identity:55/205 - (26%)
Similarity:80/205 - (39%) Gaps:40/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NAAAAAAAAGTDNHVQRY----------------QTNGNHFNQNV-PNVSAANNMQYGQNISIPY 85
            |..|||.|.|:.|...:|                |||.||.:|:. |..|::.::..||:|:.|.
plant   207 NGLAAAGAPGSVNLNYQYLMGTFIPPLQPFVPQPQTNPNHHHQHFQPPTSSSLSLWMGQDIAPPQ 271

  Fly    86 SQPQGDLNFLNAAAAADHKGKIHPKIERDREEVLNQQILQNVNQSWQTLANTANTVDYSSHL--- 147
            .||..|..|.||.||:         ...|.....::||.||.|.|..|....:....:||..   
plant   272 PQPDYDWVFGNAKAAS---------ACIDNNNTHDEQITQNANASLTTTTTLSAPSLFSSDQPQN 327

  Fly   148 --LSATLPISIQHFLKYSETIKKESTGDVLKN--GTNLASLALGGVALTPSNNGAN------GGH 202
              .::.:.:|....|:.:..|...||.....|  .|.|.|..|.....|.|.:...      |.:
plant   328 ANANSNVNMSATALLQKAAEIGATSTTTAATNDPSTFLQSFPLKSTDQTTSYDSGEKFFALFGSN 392

  Fly   203 HN-GLVGMDH 211
            :| ||:...|
plant   393 NNIGLMSRSH 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368
zf-C2H2_8 306..391 CDD:292531
C2H2 Zn finger 333..353 CDD:275368
zf-H2C2_2 345..370 CDD:290200
C2H2 Zn finger 361..381 CDD:275368
zf-H2C2_2 374..398 CDD:290200
C2H2 Zn finger 389..409 CDD:275368
NUCNP_199229.1 C2H2 Zn finger 68..88 CDD:275368
C2H2 Zn finger 109..137 CDD:275368
C2H2 Zn finger 144..163 CDD:275368
C2H2 Zn finger 171..187 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.