Sequence 1: | NP_001262485.1 | Gene: | l(3)neo38 / 41423 | FlyBaseID: | FBgn0265276 | Length: | 455 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_199229.1 | Gene: | NUC / 834439 | AraportID: | AT5G44160 | Length: | 466 | Species: | Arabidopsis thaliana |
Alignment Length: | 205 | Identity: | 55/205 - (26%) |
---|---|---|---|
Similarity: | 80/205 - (39%) | Gaps: | 40/205 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 NAAAAAAAAGTDNHVQRY----------------QTNGNHFNQNV-PNVSAANNMQYGQNISIPY 85
Fly 86 SQPQGDLNFLNAAAAADHKGKIHPKIERDREEVLNQQILQNVNQSWQTLANTANTVDYSSHL--- 147
Fly 148 --LSATLPISIQHFLKYSETIKKESTGDVLKN--GTNLASLALGGVALTPSNNGAN------GGH 202
Fly 203 HN-GLVGMDH 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(3)neo38 | NP_001262485.1 | C2H2 Zn finger | 305..325 | CDD:275368 | |
zf-C2H2_8 | 306..391 | CDD:292531 | |||
C2H2 Zn finger | 333..353 | CDD:275368 | |||
zf-H2C2_2 | 345..370 | CDD:290200 | |||
C2H2 Zn finger | 361..381 | CDD:275368 | |||
zf-H2C2_2 | 374..398 | CDD:290200 | |||
C2H2 Zn finger | 389..409 | CDD:275368 | |||
NUC | NP_199229.1 | C2H2 Zn finger | 68..88 | CDD:275368 | |
C2H2 Zn finger | 109..137 | CDD:275368 | |||
C2H2 Zn finger | 144..163 | CDD:275368 | |||
C2H2 Zn finger | 171..187 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 44 | 1.000 | Inparanoid score | I2683 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |