Sequence 1: | NP_001262485.1 | Gene: | l(3)neo38 / 41423 | FlyBaseID: | FBgn0265276 | Length: | 455 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001325405.1 | Gene: | IDD4 / 814739 | AraportID: | AT2G02080 | Length: | 516 | Species: | Arabidopsis thaliana |
Alignment Length: | 261 | Identity: | 58/261 - (22%) |
---|---|---|---|
Similarity: | 86/261 - (32%) | Gaps: | 94/261 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 251 SSSGSVGTTNASGGTG-----------TASGKKTKKKKPPKEKKPRP-KPGEIRETKALDGSTLY 303
Fly 304 CCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSH-IPDRPHVCNICMKS 367
Fly 368 FKRKEQL---------------------TLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTR---- 407
Fly 408 ---------------SHIARRV-----------KSEVSAQNVNGSAGGGGGGG-----GGNSAQS 441
Fly 442 N 442 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(3)neo38 | NP_001262485.1 | C2H2 Zn finger | 305..325 | CDD:275368 | 2/19 (11%) |
zf-C2H2_8 | 306..391 | CDD:292531 | 24/106 (23%) | ||
C2H2 Zn finger | 333..353 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 345..370 | CDD:290200 | 5/25 (20%) | ||
C2H2 Zn finger | 361..381 | CDD:275368 | 6/40 (15%) | ||
zf-H2C2_2 | 374..398 | CDD:290200 | 9/44 (20%) | ||
C2H2 Zn finger | 389..409 | CDD:275368 | 4/38 (11%) | ||
IDD4 | NP_001325405.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 44 | 1.000 | Inparanoid score | I2683 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |