Sequence 1: | NP_001262485.1 | Gene: | l(3)neo38 / 41423 | FlyBaseID: | FBgn0265276 | Length: | 455 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001324413.1 | Gene: | IDD5 / 814738 | AraportID: | AT2G02070 | Length: | 602 | Species: | Arabidopsis thaliana |
Alignment Length: | 264 | Identity: | 54/264 - (20%) |
---|---|---|---|
Similarity: | 74/264 - (28%) | Gaps: | 109/264 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 PPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALKR 342
Fly 343 KDHLTRHKLSH--------------------IPD-----------------------RPH----- 359
Fly 360 VCNICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKH------TRSHIARRVKSEV 418
Fly 419 S--------AQNVNGS-----------------------------AGGGGGGGGGNSAQSNALHG 446
Fly 447 SXGS 450 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(3)neo38 | NP_001262485.1 | C2H2 Zn finger | 305..325 | CDD:275368 | 3/19 (16%) |
zf-C2H2_8 | 306..391 | CDD:292531 | 22/132 (17%) | ||
C2H2 Zn finger | 333..353 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 345..370 | CDD:290200 | 9/72 (13%) | ||
C2H2 Zn finger | 361..381 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 374..398 | CDD:290200 | 7/23 (30%) | ||
C2H2 Zn finger | 389..409 | CDD:275368 | 7/25 (28%) | ||
IDD5 | NP_001324413.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 44 | 1.000 | Inparanoid score | I2683 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |