DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and klf11a

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_021324131.1 Gene:klf11a / 560787 ZFINID:ZDB-GENE-030131-3568 Length:479 Species:Danio rerio


Alignment Length:191 Identity:49/191 - (25%)
Similarity:77/191 - (40%) Gaps:45/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 SGGTGTASG-------KKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRSLIE 319
            :|.||..|.       .:|...||   ..|..:|..:....| .|:.::..|:.|::  ..|..:
Zfish   261 NGQTGIISAFVQTPVQMQTSGSKP---ILPHSQPLLVGSPVA-QGTVMFVVPQSQVS--QSSTCQ 319

  Fly   320 QHVIS----------------------------HAVERRFVCDI--CNAALKRKDHLTRHKLSHI 354
            |.|::                            .:..|.:||:.  |.....:..||..|..:|.
Zfish   320 QSVVTLGNTKLLPLAPAPVYVPSGQSSGVTQSDFSRRRNYVCNFQGCKKTYFKSSHLKAHLRTHT 384

  Fly   355 PDRPHVCNI--CMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIARR 413
            .::|..|:.  |.|.|.|.::|:.|...|:||||.||..|.:.|.|.|||.||.|.|:..:
Zfish   385 GEKPFSCHWEGCDKKFARSDELSRHRRTHTGEKKFVCPVCERRFMRSDHLTKHARRHMTTK 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 5/47 (11%)
zf-C2H2_8 306..391 CDD:292531 28/116 (24%)
C2H2 Zn finger 333..353 CDD:275368 5/21 (24%)
zf-H2C2_2 345..370 CDD:290200 9/26 (35%)
C2H2 Zn finger 361..381 CDD:275368 7/21 (33%)
zf-H2C2_2 374..398 CDD:290200 11/23 (48%)
C2H2 Zn finger 389..409 CDD:275368 10/19 (53%)
klf11aXP_021324131.1 MotB_plug <203..345 CDD:330912 16/89 (18%)
C2H2 Zn finger 361..383 CDD:275368 5/21 (24%)
zf-H2C2_2 375..402 CDD:316026 9/26 (35%)
C2H2 Zn finger 391..413 CDD:275368 7/21 (33%)
zf-H2C2_2 405..428 CDD:316026 10/22 (45%)
zf-C2H2 419..441 CDD:306579 11/21 (52%)
C2H2 Zn finger 421..441 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.