DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and ZBTB7B

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_016856888.1 Gene:ZBTB7B / 51043 HGNCID:18668 Length:630 Species:Homo sapiens


Alignment Length:221 Identity:54/221 - (24%)
Similarity:86/221 - (38%) Gaps:51/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 AGAVSSSGSVGTTNA-SGGTGTASGKKTKKKKPPKEKK-------------------PRPKPGEI 291
            ||.|.|||..|..:: |..|||||..:..:...|.|.:                   |...|.|:
Human   330 AGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEEL 394

  Fly   292 -RETKALDG------STLYC------------------------CPECQMAYPDRSLIEQHVISH 325
             .:..|:|.      |:|:.                        ||.|.........:.:|:.:|
Human   395 GSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLPRHMRTH 459

  Fly   326 AVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVCI 390
            ..|:.|.|::|.....|.|.|..|...|..:||:.|..|...|.....|..|:.:|:|::.:.|.
Human   460 TGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNHMHLHTGDRPYECH 524

  Fly   391 ECGKGFYRKDHLRKHTRSHIARRVKS 416
            .|.|.|.::|||::|.:......|::
Human   525 LCHKAFAKEDHLQRHLKGQNCLEVRT 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 4/19 (21%)
zf-C2H2_8 306..391 CDD:292531 23/84 (27%)
C2H2 Zn finger 333..353 CDD:275368 6/19 (32%)
zf-H2C2_2 345..370 CDD:290200 8/24 (33%)
C2H2 Zn finger 361..381 CDD:275368 5/19 (26%)
zf-H2C2_2 374..398 CDD:290200 8/23 (35%)
C2H2 Zn finger 389..409 CDD:275368 8/19 (42%)
ZBTB7BXP_016856888.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.