Sequence 1: | NP_001262485.1 | Gene: | l(3)neo38 / 41423 | FlyBaseID: | FBgn0265276 | Length: | 455 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016856888.1 | Gene: | ZBTB7B / 51043 | HGNCID: | 18668 | Length: | 630 | Species: | Homo sapiens |
Alignment Length: | 221 | Identity: | 54/221 - (24%) |
---|---|---|---|
Similarity: | 86/221 - (38%) | Gaps: | 51/221 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 247 AGAVSSSGSVGTTNA-SGGTGTASGKKTKKKKPPKEKK-------------------PRPKPGEI 291
Fly 292 -RETKALDG------STLYC------------------------CPECQMAYPDRSLIEQHVISH 325
Fly 326 AVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVCI 390
Fly 391 ECGKGFYRKDHLRKHTRSHIARRVKS 416 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(3)neo38 | NP_001262485.1 | C2H2 Zn finger | 305..325 | CDD:275368 | 4/19 (21%) |
zf-C2H2_8 | 306..391 | CDD:292531 | 23/84 (27%) | ||
C2H2 Zn finger | 333..353 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 345..370 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 361..381 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 374..398 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 389..409 | CDD:275368 | 8/19 (42%) | ||
ZBTB7B | XP_016856888.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |