DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and sr

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster


Alignment Length:490 Identity:119/490 - (24%)
Similarity:161/490 - (32%) Gaps:164/490 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFAAKFDAQTPGAFGTPPAAAANAAAAAAAAGTDNHVQRYQTNGNHFNQ-------------NVP 67
            |.|:|...:  |.|.|...|...||||||||....|.|:.|    |..|             :.|
  Fly   711 QQASKISYR--GIFTTTGNAMNAAAAAAAAAAQQQHQQQQQ----HQQQLPSPQLGVLAGPMSPP 769

  Fly    68 NVSAANN------------------------MQYGQNISIPYSQPQG------------DLNFLN 96
            :.|..|:                        ||..|.......|.|.            |.....
  Fly   770 SNSLGNSWGLPSPDKTMFQPPLFSLPAHYATMQQQQQQQQQQQQQQQQQQAAGAAPSPYDDGRAA 834

  Fly    97 AAAAADHK-------------------------------GKIHPKIERDREEVLNQQILQNVNQS 130
            |||||.|.                               |.:|    ...|:.|.||........
  Fly   835 AAAAAQHAELLGLTMDCTPLLLKQPPPSYAGASAGFPGLGDLH----SSHEQQLQQQQYVRSQPK 895

  Fly   131 WQTLANTANTVDYSSHLLSATLPISIQHFLKYSETIKKESTGDVLKNGTNLAS---LALGGVALT 192
            :|.|.:.|   ||:.......   .:|...:..:|:       ||...|:.||   .|||  .|.
  Fly   896 YQWLDSPA---DYAQQQQQVQ---QVQQQQQQQQTL-------VLPGPTSSASSSNAALG--VLI 945

  Fly   193 PSNNGANGGHHNGLVGMDHGGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSVG 257
            |...                    |..|             :..::|||..:||:|..|::.:..
  Fly   946 PKQE--------------------NYPD-------------MQPSSNGTGYSGGSGGSSAAAAAA 977

  Fly   258 TTNASGGTGTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGST--LYCCPECQMAYPDR-SLIE 319
            ...|:.....|            |..|....|....::....||  |...|.....||:| |...
  Fly   978 AAAAAAAVQLA------------EYSPSTSKGHEILSQVYQQSTVPLKLVPVKPRKYPNRPSKTP 1030

  Fly   320 QHVISHAVERRFVCDI--CNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIHS 382
            .|      ||.:.|.:  |:....|.|.||||...|...:|..|.|||:||.|.:.||.||..|:
  Fly  1031 VH------ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHT 1089

  Fly   383 GEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSE 417
            |||...|..||:.|.|.|..::|.:.|:.:|:|.|
  Fly  1090 GEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKE 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 6/20 (30%)
zf-C2H2_8 306..391 CDD:292531 34/87 (39%)
C2H2 Zn finger 333..353 CDD:275368 8/21 (38%)
zf-H2C2_2 345..370 CDD:290200 12/24 (50%)
C2H2 Zn finger 361..381 CDD:275368 11/19 (58%)
zf-H2C2_2 374..398 CDD:290200 12/23 (52%)
C2H2 Zn finger 389..409 CDD:275368 7/19 (37%)
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 8/23 (35%)
C2H2 Zn finger 1038..1060 CDD:275368 8/21 (38%)
zf-H2C2_2 1052..1077 CDD:290200 12/24 (50%)
C2H2 Zn finger 1068..1088 CDD:275368 11/19 (58%)
zf-H2C2_2 1080..1105 CDD:290200 12/24 (50%)
C2H2 Zn finger 1096..1116 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.