DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and pad

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster


Alignment Length:559 Identity:120/559 - (21%)
Similarity:177/559 - (31%) Gaps:211/559 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GTPPA-AAANAAA-AAAAAGTDNHVQRYQTN----------GNHFNQNVPNVSAANNMQYGQNIS 82
            ||.|| ...|||| .::.||..:.......|          .|...|.|.::..       :|:.
  Fly   325 GTVPAQTQLNAAALLSSLAGPQSTTNLLSPNKCFLPITIRDENSDQQIVAHIDT-------KNLV 382

  Fly    83 IPYS-------QPQGDLNFLNAAAAADHKGKIHPKIERDREEV-----LNQQILQNVNQSWQTLA 135
            :|.:       |||        .|.||.:    |.::.....:     |..|.|.|...::|   
  Fly   383 LPTTYQVQMKLQPQ--------LATADGQ----PIMQLTPTSIPATLQLTPQTLGNPGSAFQ--- 432

  Fly   136 NTANTVDYSSHL--------LSATLPISIQHFLKYSETIKKESTGD---VLKNGTNL-------- 181
              ..||..:..|        |..|..::.|..::...|    ||.:   |::|.||:        
  Fly   433 --GTTVTQNQFLAPQQPLTQLPNTAQVTSQQIIRSPHT----STTNSQLVIRNVTNIPPTPTTPT 491

  Fly   182 ----------------------ASLALGGVALTPSNNGANGGHHNGL------------------ 206
                                  :...:|     ||:.|:||...|..                  
  Fly   492 SSKKAPTFKTPSPKQKPMPSPKSKTTVG-----PSSGGSNGTSTNEFKRLITQTKPQPQVKQQQT 551

  Fly   207 VGMDHGGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTN----------- 260
            .|:...|..| .|.||.||:...:|       |.|:|.......|......|:|           
  Fly   552 AGLSASGAPT-ATSANQAAMQRLSS-------NTTITKVPKQPASLPAPAPTSNPAKLPMLNKQN 608

  Fly   261 -------------ASGGTGT-----------------------------------------ASGK 271
                         |.....|                                         .||:
  Fly   609 ITISRISMQTAPKAQSKPSTTSPTPASQPIPVSVPALSQAQPPPLAAQHKKIVRKPPENQDTSGQ 673

  Fly   272 KTKKKKPPKEKKPRPKP---------GEIRETKALDGSTLYCCPECQMAYPDRSLIEQHVISHAV 327
            |.|..:||::..|.|:.         .|...|..|      .||.|:..:..:..:.|||..||.
  Fly   674 KVKAARPPQQILPSPQQEGQNATHSGSEAPTTSGL------ICPTCKREFKKKEHLTQHVKLHAG 732

  Fly   328 ERRFVC--DICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIH---SGEKKH 387
            .|.|.|  :.|:....||:||:||.:||...:.:.|.:|.|.|.||:.|..|..||   |.|..:
  Fly   733 LRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYTCEVCKKPFSRKDNLNKHRRIHTQTSTETLY 797

  Fly   388 VCIECGKGFYRKDHLRKHTRSHIARRVKSEVSAQNVNGS 426
            .|..|.|.|..|.|..||...|  ::::.|.:|.....|
  Fly   798 CCDVCNKNFATKLHYEKHREMH--KKIRPESAAPGATAS 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 6/19 (32%)
zf-C2H2_8 306..391 CDD:292531 32/89 (36%)
C2H2 Zn finger 333..353 CDD:275368 8/21 (38%)
zf-H2C2_2 345..370 CDD:290200 10/24 (42%)
C2H2 Zn finger 361..381 CDD:275368 8/19 (42%)
zf-H2C2_2 374..398 CDD:290200 10/26 (38%)
C2H2 Zn finger 389..409 CDD:275368 8/19 (42%)
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 6/19 (32%)
zf-C2H2 736..760 CDD:278523 9/23 (39%)
C2H2 Zn finger 738..760 CDD:275368 8/21 (38%)
zf-H2C2_2 752..777 CDD:290200 10/24 (42%)
zf-C2H2 766..788 CDD:278523 8/21 (38%)
C2H2 Zn finger 768..788 CDD:275368 8/19 (42%)
zf-H2C2_2 780..808 CDD:290200 10/27 (37%)
C2H2 Zn finger 799..819 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.