DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and hkb

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster


Alignment Length:289 Identity:66/289 - (22%)
Similarity:109/289 - (37%) Gaps:88/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 TIKKESTGDVLKNGTNLASLALG----------GVALTPSNNGANGGHHNGLVGMDHGGHMTNMT 219
            |:|:|.....:|  |.|||.:.|          ..:.:.|:|.:...:...|   :|..:....|
  Fly    33 TVKQEPEAITIK--TELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEAL---NHSSYTRTST 92

  Fly   220 DANGAA----LTNGASNGVNGNANGTVTNGG----------------AGAVSSSGSVGTTNASGG 264
            ....||    .::..|:.::.:|..|.:...                |.|.:::.:..|..|..|
  Fly    93 PLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPG 157

  Fly   265 TGT---ASG----------KKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRS 316
            .|.   ..|          .:..:.|....:|.|||.              :.||.|.:|:.:..
  Fly   158 FGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKK--------------FKCPNCDVAFSNNG 208

  Fly   317 LIEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIH 381
            .::.|:..|..||.|.||:                          |.|.|:|.|.|:||.|..||
  Fly   209 QLKGHIRIHTGERPFKCDV--------------------------NTCGKTFTRNEELTRHKRIH 247

  Fly   382 SGEKKHVCIECGKGFYRKDHLRKHTRSHI 410
            :|.:.:.|..|||.|.|:|||:||.::|:
  Fly   248 TGLRPYPCSACGKKFGRRDHLKKHMKTHM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 5/19 (26%)
zf-C2H2_8 306..391 CDD:292531 23/84 (27%)
C2H2 Zn finger 333..353 CDD:275368 2/19 (11%)
zf-H2C2_2 345..370 CDD:290200 4/24 (17%)
C2H2 Zn finger 361..381 CDD:275368 9/19 (47%)
zf-H2C2_2 374..398 CDD:290200 11/23 (48%)
C2H2 Zn finger 389..409 CDD:275368 11/19 (58%)
hkbNP_524221.1 COG5048 195..>261 CDD:227381 26/91 (29%)
zf-C2H2 195..217 CDD:278523 5/21 (24%)
C2H2 Zn finger 197..217 CDD:275368 5/19 (26%)
zf-H2C2_2 210..236 CDD:290200 11/51 (22%)
C2H2 Zn finger 225..247 CDD:275368 11/47 (23%)
zf-H2C2_2 239..264 CDD:290200 11/24 (46%)
C2H2 Zn finger 255..275 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.