| Sequence 1: | NP_001262485.1 | Gene: | l(3)neo38 / 41423 | FlyBaseID: | FBgn0265276 | Length: | 455 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011509461.1 | Gene: | SP5 / 389058 | HGNCID: | 14529 | Length: | 454 | Species: | Homo sapiens |
| Alignment Length: | 201 | Identity: | 60/201 - (29%) |
|---|---|---|---|
| Similarity: | 89/201 - (44%) | Gaps: | 30/201 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 233 GVNGNANGTVTNGGAGAVSSSGSVGTTNASGGTGTASGKKTKK---KKPPKEKKPRPKPGEIRET 294
Fly 295 KA-LDGSTLYC----CPECQM------AYPDRSLIEQHVISHAVERRFVCDI--CNAALKRKDHL 346
Fly 347 TRHKLSHIPDRPHVCN--ICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSH 409
Fly 410 IARRVK 415 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| l(3)neo38 | NP_001262485.1 | C2H2 Zn finger | 305..325 | CDD:275368 | 8/25 (32%) |
| zf-C2H2_8 | 306..391 | CDD:292531 | 31/94 (33%) | ||
| C2H2 Zn finger | 333..353 | CDD:275368 | 5/21 (24%) | ||
| zf-H2C2_2 | 345..370 | CDD:290200 | 13/26 (50%) | ||
| C2H2 Zn finger | 361..381 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 374..398 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 389..409 | CDD:275368 | 12/19 (63%) | ||
| SP5 | XP_011509461.1 | C2H2 Zn finger | 357..376 | CDD:275368 | 4/18 (22%) |
| COG5048 | <367..440 | CDD:227381 | 33/72 (46%) | ||
| zf-H2C2_2 | 368..395 | CDD:290200 | 13/26 (50%) | ||
| C2H2 Zn finger | 384..406 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 398..421 | CDD:290200 | 11/22 (50%) | ||
| zf-C2H2 | 412..434 | CDD:278523 | 12/21 (57%) | ||
| C2H2 Zn finger | 414..434 | CDD:275368 | 12/19 (63%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||