DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)neo38 and ZBTB41

DIOPT Version :9

Sequence 1:	NP_001262485.1	Gene:	l(3)neo38 / 41423	FlyBaseID:	FBgn0265276	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	NP_919290.2	Gene:	ZBTB41 / 360023	HGNCID:	24819	Length:	909	Species:	Homo sapiens

Alignment Length:	146	Identity:	45/146 - (30%)
Similarity:	70/146 - (47%)	Gaps:	30/146 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   305 CPECQMAYPDRSLIEQHV-ISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSF 368
            |..|...:.|...:::|: .:|..:|::.|.||..:::.:..|..|...|..::||:|:||.:||
Human   520 CDICGRQFNDTGNLKRHIECTHGGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSF 584

  Fly   369 K----------------------------RKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKH 405
            :                            |.:.||.|..||||||.|.|.||||.|.|:|||..|
Human   585 RHGSSYRLHLRVHHDDKRYECDECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVH 649

  Fly   406 TRS-HIARRVKSEVSA 420
            .:| |:..:|..:..|
Human   650 YKSVHLGEKVWQKYKA 665

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)neo38	NP_001262485.1	C2H2 Zn finger	305..325	CDD:275368	4/20 (20%)
		zf-C2H2_8	306..391	CDD:292531	30/113 (27%)
		C2H2 Zn finger	333..353	CDD:275368	5/19 (26%)
		zf-H2C2_2	345..370	CDD:290200	10/52 (19%)
		C2H2 Zn finger	361..381	CDD:275368	9/47 (19%)
		zf-H2C2_2	374..398	CDD:290200	16/23 (70%)
		C2H2 Zn finger	389..409	CDD:275368	12/20 (60%)
ZBTB41	NP_919290.2	BTB_POZ_ZBTB41	66..179	CDD:349535
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	252..344
		C2H2 Zn finger	363..383	CDD:275368
		C2H2 Zn finger	391..411	CDD:275368
		C2H2 Zn finger	424..442	CDD:275368
		C2H2 Zn finger	465..485	CDD:275368
		C2H2 Zn finger	493..510	CDD:275368
		C2H2 Zn finger	520..541	CDD:275368	4/20 (20%)
		C2H2 Zn finger	549..569	CDD:275368	5/19 (26%)
		C2H2 Zn finger	577..597	CDD:275368	5/19 (26%)
		zf-C2H2	603..625	CDD:395048	4/21 (19%)
		C2H2 Zn finger	605..625	CDD:275368	4/19 (21%)
		C2H2 Zn finger	633..651	CDD:275368	11/17 (65%)
		C2H2 Zn finger	670..687	CDD:275368
		C2H2 Zn finger	698..718	CDD:275368
		C2H2 Zn finger	726..743	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S4053
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950