DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and odd

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:218 Identity:60/218 - (27%)
Similarity:85/218 - (38%) Gaps:38/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 HHNGLVGMDH-GGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTNASGGT 265
            ||:|.....| ..|......| |....:.|..|.:..|..|:..||||..|..       .||.|
  Fly   155 HHHGHPHHPHPHPHHVRPYPA-GLHSLHAAVMGRHFGAMPTLKLGGAGGASGV-------PSGAT 211

  Fly   266 GTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRSLIEQHVISHAVERR 330
            |::..||.                             :.|..|...:.....:..|..:|..||.
  Fly   212 GSSRPKKQ-----------------------------FICKYCNRQFTKSYNLLIHERTHTDERP 247

  Fly   331 FVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKG 395
            :.||||..|.:|:|||..|:..|..|:|..|:.|.|.|.:...|.:|.|.|..|..|.|..|.:.
  Fly   248 YSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRS 312

  Fly   396 FYRKDHLRKHTRSHIARRVKSEV 418
            |.::.:|:.|.:||..:..|..|
  Fly   313 FNQRANLKSHLQSHSEQSTKEVV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 3/19 (16%)
zf-C2H2_8 306..391 CDD:292531 29/84 (35%)
C2H2 Zn finger 333..353 CDD:275368 10/19 (53%)
zf-H2C2_2 345..370 CDD:290200 10/24 (42%)
C2H2 Zn finger 361..381 CDD:275368 7/19 (37%)
zf-H2C2_2 374..398 CDD:290200 9/23 (39%)
C2H2 Zn finger 389..409 CDD:275368 5/19 (26%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 44/166 (27%)
C2H2 Zn finger 222..242 CDD:275368 3/19 (16%)
zf-H2C2_2 234..259 CDD:290200 9/24 (38%)
C2H2 Zn finger 250..270 CDD:275368 10/19 (53%)
zf-H2C2_2 262..285 CDD:290200 9/22 (41%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-C2H2 304..326 CDD:278523 6/21 (29%)
C2H2 Zn finger 306..326 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.