DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and sp3b

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_005165855.1 Gene:sp3b / 322961 ZFINID:ZDB-GENE-110815-3 Length:783 Species:Danio rerio


Alignment Length:559 Identity:132/559 - (23%)
Similarity:188/559 - (33%) Gaps:180/559 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGPFSGIHQFAAKFDAQTPGAFGTPPAAAANAAAAAAAAGTDNHVQRYQTNGNHFNQNVPNVSAA 72
            |...:.:...|:..|..|   .||..|...:.....|.|...|.:|...:...|. |.:|.||.|
Zfish   254 GADGASLSYTASAADGST---LGTDIAILPDGTQGIATATNANDLQGLLSQSGHV-QQIPTVSLA 314

  Fly    73 N-----------NMQYGQNIS-IPY-SQPQGDLNFLNAAAAADHKGKIHPKIERDREEVL----- 119
            .           ||....||: :|. |....||..|..|.|.    .|...:..|.:.::     
Zfish   315 GSGFGTQGQVVANMGLPGNITLVPINSLSNVDLESLGLAGAQ----TIATSVTADGQLIMTGPTT 375

  Fly   120 ----NQ----QILQNVNQSWQTLANTANT---VDYSSHLLSATLPISIQHFLKYSETIKKESTGD 173
                ||    :..:::|      ||.||.   |..::...|.:||          |||  :.|| 
Zfish   376 TTSDNQGESGKCTESLN------ANDANANAFVPTTTSSTSTSLP----------ETI--DGTG- 421

  Fly   174 VLKNGTNLASLALGGVALTPSNNGANGGHHN-GLVGMDH--GG----HMTNMTDANGAALTNGAS 231
            ||...|                 ..:.||.: ..:..:|  ||    .:.....|:|||.|..:.
Zfish   422 VLTQAT-----------------AVSAGHQDLSYIQQNHTTGGEQVVQLLPAQTADGAAQTLQSV 469

  Fly   232 NGVNGNA----NGTVTNGG----------------------AGAVSSS------------GSVGT 258
            ..:|...    ..||:..|                      ||.|||.            |..||
Zfish   470 QLLNAGTFLIQAQTVSPTGQIQWQTFQVQGVQNLQNLQLPAAGGVSSPQITLAPVQTLSLGQSGT 534

  Fly   259 TNASGG-------TGTASGKKTK------------KKKPPKEKKP------------------RP 286
            |.|.|.       |..:.|:..:            |::|..:..|                  ..
Zfish   535 TGALGQIPNLQTVTVNSVGQYQQDENTESHTDIQIKEEPESDDWPNSTLSTSDLAHLRVRLVEED 599

  Fly   287 KPGEIRETKALDGSTLYC-CPECQMAYPDRSLIEQHVISHAVERRFVCDI--CNAALKRKDHLTR 348
            ..|..:|.|.|  ..:.| ||.|:.|....|       |...:::.:|.|  |.....:..||..
Zfish   600 MEGTGQEGKRL--RRVACTCPNCKEAGGRGS-------SMGKKKQHICHIPGCGKVYGKTSHLRA 655

  Fly   349 HKLSHIPDRPHVC--NICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIA 411
            |...|..:||.:|  :.|.|.|.|.::|..|...|:||||.||.||.|.|.|.|||.||.::|  
Zfish   656 HLRWHSGERPFICSWSYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTH-- 718

  Fly   412 RRVKSEVSAQNVNGSAGGGGGGGGGNSAQSNALHGSXGS 450
                     ||..|.....|.|....:|.|:.:....|:
Zfish   719 ---------QNKKGLNSNTGVGQTEAAAPSDTIITGGGA 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 5/19 (26%)
zf-C2H2_8 306..391 CDD:292531 28/88 (32%)
C2H2 Zn finger 333..353 CDD:275368 6/21 (29%)
zf-H2C2_2 345..370 CDD:290200 10/26 (38%)
C2H2 Zn finger 361..381 CDD:275368 7/21 (33%)
zf-H2C2_2 374..398 CDD:290200 13/23 (57%)
C2H2 Zn finger 389..409 CDD:275368 11/19 (58%)
sp3bXP_005165855.1 THAP 8..85 CDD:283206
C2H2 Zn finger 638..660 CDD:275368 6/21 (29%)
COG5048 <651..728 CDD:227381 34/87 (39%)
zf-C2H2 666..690 CDD:278523 7/23 (30%)
C2H2 Zn finger 668..690 CDD:275368 7/21 (33%)
zf-H2C2_2 682..705 CDD:290200 12/22 (55%)
zf-C2H2 696..718 CDD:278523 12/21 (57%)
C2H2 Zn finger 698..718 CDD:275368 11/19 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.