DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and btd

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster


Alignment Length:451 Identity:98/451 - (21%)
Similarity:146/451 - (32%) Gaps:141/451 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NHVQRYQTNGNHFNQNVPNVSAANNMQYGQNISIPYSQPQGDL-NFLNAAA-------------- 99
            :|.|..|.:..|..|...........|..|...  ..|||... :||:|||              
  Fly    49 SHQQAQQQHMQHLTQQQQQQQQQQQQQQQQQQQ--QQQPQQQQHDFLSAAALLSAPPSLSGSSSG 111

  Fly   100 ----AADHKGKIHPKIERDREEVLNQQILQNVNQSWQTLANTANTVDYSSHLLSA---------T 151
                ::...||...|:|....:                 |::..|...:|.:.||         .
  Fly   112 SSSGSSPLYGKPPMKLELPYPQ-----------------ASSTGTASPNSSIQSAPSSASVSPSI 159

  Fly   152 LPISIQHFLKYSETIKKESTGDVLKNGTNLASLALGG--VALTPSNNGANGGHHNGLVGMDHGGH 214
            .|...|.|...|.:....:|  .|...|..|:.||.|  .:.:||::.|:.              
  Fly   160 FPSPAQSFASISASPSTPTT--TLAPPTTAAAGALAGSPTSSSPSSSAASA-------------- 208

  Fly   215 MTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTNASGGTGTASGKKTKKKKP- 278
                  |..||....|:..:           ||.||:|: :.|...|..|.|.|     :.:.| 
  Fly   209 ------AAAAAAAAAAAADL-----------GAAAVASA-AYGWNTAYSGLGPA-----RSQFPY 250

  Fly   279 ----------------------PKEKKPRP-----KPG----EIRETKALDGSTLYC-CPEC--- 308
                                  .:|:..:|     .||    :|.....|...::.| ||.|   
  Fly   251 AQYASDYYGNAVGMSSSAAWFSHQERLYQPWSSQSYPGFNFDDIAFQTQLQRRSVRCTCPNCTNE 315

  Fly   309 -----QMAYPDRSLIEQHVISHAVERRFVCDI--CNAALKRKDHLTRHKLSHIPDRPHVCNICMK 366
                 .:..||....:||          :|.|  |.....:..||..|...|..:||.:|..|.|
  Fly   316 MSGLPPIVGPDERGRKQH----------ICHIPGCERLYGKASHLKTHLRWHTGERPFLCLTCGK 370

  Fly   367 SFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSEVSAQNVNGSA 427
            .|.|.::|..|...|:..:.:.|..|.|.|.|.|||.||.::|...:...:|.|......|
  Fly   371 RFSRSDELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQA 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 7/27 (26%)
zf-C2H2_8 306..391 CDD:292531 24/94 (26%)
C2H2 Zn finger 333..353 CDD:275368 6/21 (29%)
zf-H2C2_2 345..370 CDD:290200 10/24 (42%)
C2H2 Zn finger 361..381 CDD:275368 7/19 (37%)
zf-H2C2_2 374..398 CDD:290200 7/23 (30%)
C2H2 Zn finger 389..409 CDD:275368 10/19 (53%)
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 4/18 (22%)
zf-H2C2_2 349..374 CDD:290200 10/24 (42%)
C2H2 Zn finger 365..385 CDD:275368 7/19 (37%)
zf-H2C2_2 377..402 CDD:290200 7/24 (29%)
zf-C2H2 391..413 CDD:278523 10/21 (48%)
C2H2 Zn finger 393..413 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.