Sequence 1: | NP_001262485.1 | Gene: | l(3)neo38 / 41423 | FlyBaseID: | FBgn0265276 | Length: | 455 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
Alignment Length: | 241 | Identity: | 56/241 - (23%) |
---|---|---|---|
Similarity: | 105/241 - (43%) | Gaps: | 33/241 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 LTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTN---ASGGTGTASGKKTKKKKPPKEKKPRPK 287
Fly 288 PGEIRETKALDGSTLY-------------------CCPECQMAYPDRSLIEQHVISHAVERRFVC 333
Fly 334 DICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVC--IECGKGF 396
Fly 397 YRKDHLRKHTRSH---------IARRVKSEVSAQNVNGSAGGGGGG 433 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(3)neo38 | NP_001262485.1 | C2H2 Zn finger | 305..325 | CDD:275368 | 5/19 (26%) |
zf-C2H2_8 | 306..391 | CDD:292531 | 28/86 (33%) | ||
C2H2 Zn finger | 333..353 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 345..370 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 361..381 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 374..398 | CDD:290200 | 11/25 (44%) | ||
C2H2 Zn finger | 389..409 | CDD:275368 | 7/21 (33%) | ||
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 42/149 (28%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 4/24 (17%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | |||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 44 | 1.000 | Inparanoid score | I2683 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |