DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and Sp5

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001100022.1 Gene:Sp5 / 296510 RGDID:1308499 Length:398 Species:Rattus norvegicus


Alignment Length:217 Identity:64/217 - (29%)
Similarity:94/217 - (43%) Gaps:46/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 TVTNGGAGAVSSSGSVGTTNASGGTG-----------------TASGKKTKKKKPPKEKKPRPKP 288
            ::...|||. .|||..||:.:|...|                 .|:.::.....|....:.:.:.
  Rat   191 SIPQSGAGP-GSSGVPGTSLSSACAGPPHAPRFPASAAAAAAAAAALQRGLVLGPSDFAQYQSQI 254

  Fly   289 GEIRETKA-LDGSTLYC----CPECQM------AYPDRSLIEQHVISHAVERRFVCDI--CNAAL 340
            ..:.:||| |..:...|    ||.||.      |.|.:.  :||          ||.:  |....
  Rat   255 AALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKK--KQH----------VCHVPGCGKVY 307

  Fly   341 KRKDHLTRHKLSHIPDRPHVCN--ICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLR 403
            .:..||..|...|..:||.|||  .|.|||.|.::|..|:..|:|||:..|.||||.|.|.|||.
  Rat   308 GKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPECGKRFMRSDHLA 372

  Fly   404 KHTRSHIARRVK-SEVSAQNVN 424
            ||.::|..:::| :|...:..|
  Rat   373 KHVKTHQNKKLKVAEAGVKREN 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 8/25 (32%)
zf-C2H2_8 306..391 CDD:292531 31/94 (33%)
C2H2 Zn finger 333..353 CDD:275368 5/21 (24%)
zf-H2C2_2 345..370 CDD:290200 13/26 (50%)
C2H2 Zn finger 361..381 CDD:275368 9/21 (43%)
zf-H2C2_2 374..398 CDD:290200 12/23 (52%)
C2H2 Zn finger 389..409 CDD:275368 12/19 (63%)
Sp5NP_001100022.1 SP1-4_N 31..>47 CDD:425404
SP5_N 106..297 CDD:412096 25/118 (21%)
C2H2 Zn finger 301..320 CDD:275368 4/18 (22%)
COG5048 <311..384 CDD:227381 33/72 (46%)
C2H2 Zn finger 328..350 CDD:275368 9/21 (43%)
zf-H2C2_2 342..365 CDD:404364 11/22 (50%)
C2H2 Zn finger 358..378 CDD:275368 12/19 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.