DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and Zbtb41

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_766231.2 Gene:Zbtb41 / 226470 MGIID:2444487 Length:908 Species:Mus musculus


Alignment Length:146 Identity:45/146 - (30%)
Similarity:70/146 - (47%) Gaps:30/146 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 CPECQMAYPDRSLIEQHV-ISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSF 368
            |..|...:.|...:::|: .:|..:|::.|.||..:::.:..|..|...|..::||:|:||.:||
Mouse   519 CDICGRQFNDTGNLKRHIECTHGGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSF 583

  Fly   369 K----------------------------RKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKH 405
            :                            |.:.||.|..||||||.|.|.||||.|.|:|||..|
Mouse   584 RHGSSYRLHLRVHHDDKRYECDECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVH 648

  Fly   406 TRS-HIARRVKSEVSA 420
            .:| |:..:|..:..|
Mouse   649 YKSVHLGEKVWQKYKA 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 4/20 (20%)
zf-C2H2_8 306..391 CDD:292531 30/113 (27%)
C2H2 Zn finger 333..353 CDD:275368 5/19 (26%)
zf-H2C2_2 345..370 CDD:290200 10/52 (19%)
C2H2 Zn finger 361..381 CDD:275368 9/47 (19%)
zf-H2C2_2 374..398 CDD:290200 16/23 (70%)
C2H2 Zn finger 389..409 CDD:275368 12/20 (60%)
Zbtb41NP_766231.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..59
BTB_POZ_ZBTB41 67..180 CDD:349535
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..344
CobT <270..>339 CDD:130712
C2H2 Zn finger 362..382 CDD:275368
C2H2 Zn finger 390..410 CDD:275368
C2H2 Zn finger 423..441 CDD:275368
C2H2 Zn finger 464..484 CDD:275368
C2H2 Zn finger 492..509 CDD:275368
C2H2 Zn finger 519..540 CDD:275368 4/20 (20%)
C2H2 Zn finger 548..568 CDD:275368 5/19 (26%)
zf-H2C2_2 561..585 CDD:372612 10/23 (43%)
C2H2 Zn finger 576..596 CDD:275368 5/19 (26%)
zf-C2H2 602..624 CDD:333835 4/21 (19%)
C2H2 Zn finger 604..624 CDD:275368 4/19 (21%)
zf-H2C2_2 616..641 CDD:372612 16/24 (67%)
C2H2 Zn finger 632..650 CDD:275368 11/17 (65%)
C2H2 Zn finger 669..686 CDD:275368
C2H2 Zn finger 697..717 CDD:275368
C2H2 Zn finger 725..742 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4053
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.