| Sequence 1: | NP_001262485.1 | Gene: | l(3)neo38 / 41423 | FlyBaseID: | FBgn0265276 | Length: | 455 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_862825.1 | Gene: | ZBTB12 / 221527 | HGNCID: | 19066 | Length: | 459 | Species: | Homo sapiens |
| Alignment Length: | 254 | Identity: | 61/254 - (24%) |
|---|---|---|---|
| Similarity: | 91/254 - (35%) | Gaps: | 64/254 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 200 GGHHNGL-VGMDHGGHMTNMTDANGAALTNGASNGV--------------------NGNANGTVT 243
Fly 244 NG----GAGAVSSSGSVGTTNASGGTGTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYC 304
Fly 305 CPEC-----QMAYPDRSLIEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNIC 364
Fly 365 MKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSEVSAQNV 423 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| l(3)neo38 | NP_001262485.1 | C2H2 Zn finger | 305..325 | CDD:275368 | 7/24 (29%) |
| zf-C2H2_8 | 306..391 | CDD:292531 | 26/89 (29%) | ||
| C2H2 Zn finger | 333..353 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 345..370 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 361..381 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 374..398 | CDD:290200 | 8/23 (35%) | ||
| C2H2 Zn finger | 389..409 | CDD:275368 | 6/19 (32%) | ||
| ZBTB12 | NP_862825.1 | BTB | 23..127 | CDD:306997 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 153..179 | ||||
| C2H2 Zn finger | 335..355 | CDD:275368 | 4/22 (18%) | ||
| zf-C2H2 | 359..381 | CDD:306579 | 6/21 (29%) | ||
| COG5048 | <361..>448 | CDD:227381 | 27/91 (30%) | ||
| C2H2 Zn finger | 361..381 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 389..409 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 417..435 | CDD:275368 | 6/17 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||