DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo38 and M03D4.4

DIOPT Version :9

Sequence 1:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:155 Identity:47/155 - (30%)
Similarity:70/155 - (45%) Gaps:17/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 TASGKKTKKKKPPKEKKPRPKPG-----EIRETKAL-----------DGSTLYCCPECQMAYPDR 315
            |.|.:.:.....|.||....:.|     :..|..|:           .|...:.|.:|...:..|
 Worm    64 TDSSQLSMNPTTPSEKSSSGEKGRYECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTR 128

  Fly   316 SLIEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVI 380
            .|:::|.:.|..||..||..||.|..:|.|||:|.:.|...|||.|..|.|:|..|..|..|:.|
 Worm   129 QLLKKHWMWHTGERSHVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKI 193

  Fly   381 HSGEKKHVCIECGKGFYRKDHLRKH 405
            |. |:...|.:||:.|.::..|.:|
 Worm   194 HQ-ERGFSCQQCGRSFLKQVMLDEH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 5/19 (26%)
zf-C2H2_8 306..391 CDD:292531 32/84 (38%)
C2H2 Zn finger 333..353 CDD:275368 9/19 (47%)
zf-H2C2_2 345..370 CDD:290200 12/24 (50%)
C2H2 Zn finger 361..381 CDD:275368 7/19 (37%)
zf-H2C2_2 374..398 CDD:290200 9/23 (39%)
C2H2 Zn finger 389..409 CDD:275368 6/17 (35%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 2/19 (11%)
zf-H2C2_2 102..127 CDD:290200 3/24 (13%)
C2H2 Zn finger 118..138 CDD:275368 5/19 (26%)
C2H2 Zn finger 146..166 CDD:275368 9/19 (47%)
zf-H2C2_2 158..181 CDD:290200 11/22 (50%)
zf-C2H2 172..194 CDD:278523 8/21 (38%)
C2H2 Zn finger 174..194 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.