DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and YBR062C

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_009618.2 Gene:YBR062C / 852354 SGDID:S000000266 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:39/163 - (23%)
Similarity:59/163 - (36%) Gaps:53/163 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1076 TSGSGNSSVAAQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPL 1140
            |||.|:   |...|...|:|..|..|::.|. ..:|.|.:.:                       
Yeast    46 TSGEGD---AHSDSTLLLRLLSQMLPESLQE-EWLQEMDKGK----------------------- 83

  Fly  1141 SLGSRILIAPSRPNRGATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENE---VRR 1202
            |.|.....|.|.|.       |.:..|              :..:.|:||...: :|:|   |..
Yeast    84 SAGCPDTFAASLPR-------INKKKL--------------KATDNCSICYTNY-LEDEYPLVVE 126

  Fly  1203 LP-CMHLFHTDCVDQWLVTNKHCPICRVDIETH 1234
            || |.|.|..:|:..||..:..||:||.::..|
Yeast   127 LPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGH 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 16/46 (35%)
zf-RING_2 1187..1228 CDD:290367 16/44 (36%)
YBR062CNP_009618.2 RING_Ubox 109..153 CDD:418438 16/44 (36%)
RING-H2 finger (C3H2C3-type) 109..152 CDD:319361 16/43 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.