Sequence 1: | NP_001262484.1 | Gene: | CG6923 / 41420 | FlyBaseID: | FBgn0037944 | Length: | 1265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_201297.1 | Gene: | CIP8 / 836616 | AraportID: | AT5G64920 | Length: | 334 | Species: | Arabidopsis thaliana |
Alignment Length: | 327 | Identity: | 70/327 - (21%) |
---|---|---|---|
Similarity: | 101/327 - (30%) | Gaps: | 142/327 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 1037 CVHARNGPVSSLDPAYYPPYDAAPAAAAPPPSPQQQSPATSGSGNSSVAAQ--ASMRHLQLQPQQ 1099
Fly 1100 QPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPLSLGSR------------------- 1145
Fly 1146 -------------------------ILIAPSRPNRGATLE------TIERNTLPHKY---RRVRR 1176
Fly 1177 PSETDED---------------------------AEKCAI-CLNLFEI---ENEV---------- 1200
Fly 1201 -------RRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDA-----LPPSSSGVPDAANS 1253
Fly 1254 AA 1255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6923 | NP_001262484.1 | zf-rbx1 | <1185..1228 | CDD:289448 | 20/63 (32%) |
zf-RING_2 | 1187..1228 | CDD:290367 | 19/61 (31%) | ||
CIP8 | NP_201297.1 | zinc_ribbon_9 | 14..46 | CDD:405118 | 3/10 (30%) |
RING_Ubox | 257..298 | CDD:418438 | 12/40 (30%) | ||
RING-H2 finger (C3H2C3-type) | 257..297 | CDD:319361 | 12/39 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1249953at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |