DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and CIP8

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_201297.1 Gene:CIP8 / 836616 AraportID:AT5G64920 Length:334 Species:Arabidopsis thaliana


Alignment Length:327 Identity:70/327 - (21%)
Similarity:101/327 - (30%) Gaps:142/327 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly  1037 CVHARNGPVSSLDPAYYPPYDAAPAAAAPPPSPQQQSPATSGSGNSSVAAQ--ASMRHLQLQPQQ 1099
            |.....|.|.|:.|        .|||.:.|..||..||..:.. :||:.:.  ..:|.|...|  
plant    35 CCECNKGFVESIQP--------TPAAYSSPAPPQPLSPDLNVE-DSSIGSHFLQMLRLLAHAP-- 88

  Fly  1100 QPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPLSLGSR------------------- 1145
               :|:|||                 .|...|..|.....|.|.||                   
plant    89 ---SQRSPP-----------------RHLDVLSYEDDFFRLELNSRNEIDDDEDEDEDDGDEEEE 133

  Fly  1146 -------------------------ILIAPSRPNRGATLE------TIERNTLPHKY---RRVRR 1176
                                     :....||..|...|:      .||.|::..:.   |....
plant   134 DEEENLTVNDEEDEEDDLRRRNRFPLTTTQSRTGRNRILDWAEILMGIEDNSIEFRMESDRYAGN 198

  Fly  1177 PSETDED---------------------------AEKCAI-CLNLFEI---ENEV---------- 1200
            |::..:|                           |.|.|| .|..||:   |.|:          
plant   199 PADYIDDAAGYEALLQNLAEGDGGGGGGRRGAPPAAKSAIEALETFEVSSSEGEMVMVCAVCKDG 263

  Fly  1201 -------RRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDA-----LPPSSSGVPDAANS 1253
                   ::|||.|.:|.||:..||.|...||:||..:||   :||     ....:|.|.|:|.:
plant   264 MVMGETGKKLPCGHCYHGDCIVPWLGTRNSCPVCRFQLET---DDAEYEEERKKRTSTVSDSAAA 325

  Fly  1254 AA 1255
            ::
plant   326 SS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 20/63 (32%)
zf-RING_2 1187..1228 CDD:290367 19/61 (31%)
CIP8NP_201297.1 zinc_ribbon_9 14..46 CDD:405118 3/10 (30%)
RING_Ubox 257..298 CDD:418438 12/40 (30%)
RING-H2 finger (C3H2C3-type) 257..297 CDD:319361 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.