powered by:
Protein Alignment CG6923 and AT5G37230
DIOPT Version :9
Sequence 1: | NP_001262484.1 |
Gene: | CG6923 / 41420 |
FlyBaseID: | FBgn0037944 |
Length: | 1265 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_198539.1 |
Gene: | AT5G37230 / 833697 |
AraportID: | AT5G37230 |
Length: | 208 |
Species: | Arabidopsis thaliana |
Alignment Length: | 61 |
Identity: | 23/61 - (37%) |
Similarity: | 34/61 - (55%) |
Gaps: | 8/61 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 1181 DEDAEKCAICLNLF--EIENEVRRLP-CMHLFHTDCVDQWLVTNKHCPICR-----VDIET 1233
||:...|:||:..| ..::.:..|| |.||||..|:.:||...:.||:|| .|:||
plant 147 DEEETTCSICMEDFSESHDDNIILLPDCFHLFHQSCIFKWLKRQRSCPLCRRVPYEEDLET 207
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1249953at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.