DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT5G37230

DIOPT Version :10

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_198539.1 Gene:AT5G37230 / 833697 AraportID:AT5G37230 Length:208 Species:Arabidopsis thaliana


Alignment Length:61 Identity:23/61 - (37%)
Similarity:34/61 - (55%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1181 DEDAEKCAICLNLF--EIENEVRRLP-CMHLFHTDCVDQWLVTNKHCPICR-----VDIET 1233
            ||:...|:||:..|  ..::.:..|| |.||||..|:.:||...:.||:||     .|:||
plant   147 DEEETTCSICMEDFSESHDDNIILLPDCFHLFHQSCIFKWLKRQRSCPLCRRVPYEEDLET 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 HRD1 <1155..>1256 CDD:227568 23/61 (38%)
RING-H2_RNF111-like 1185..1230 CDD:438137 18/52 (35%)
AT5G37230NP_198539.1 RING-H2_PA-TM-RING 152..197 CDD:438118 16/44 (36%)

Return to query results.
Submit another query.