DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT5G01980

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_195818.1 Gene:AT5G01980 / 831911 AraportID:AT5G01980 Length:493 Species:Arabidopsis thaliana


Alignment Length:189 Identity:50/189 - (26%)
Similarity:73/189 - (38%) Gaps:34/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1068 SPQQQSPATSGSGNSSVAAQASMRHLQLQPQQ--QPQAQQSPPVMQHMQRQRAIHHHMFHHHYSP 1130
            |.::......|:|.|.||. ...|:....|.:  ....:...|.::...|||.|.    ..|...
plant   219 SDEEDREWEEGAGPSGVAG-TRYRNYLASPSESYSSMTRFDSPELERSFRQRIIE----RRHSLS 278

  Fly  1131 LHLEIGLAPLSLGSRILIAPSRPNRGATL------ETIERNTLPHKYRRVRRPSE---------- 1179
            .::..||..|.      .:|...|.|..|      |.:|:.......||...|:.          
plant   279 RNIFTGLEDLD------FSPYAANVGDYLDERGFDELLEQLAESDNSRRGAPPASVSCVRNLPRV 337

  Fly  1180 --TDEDAEK---CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIET 1233
              .:|...|   ||||..||.:.||..:|||:||:|..|:..||.....||:||.::.|
plant   338 IIAEEHVMKGLVCAICKELFSLRNETTQLPCLHLYHAHCIVPWLSARNSCPLCRYELPT 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 20/45 (44%)
zf-RING_2 1187..1228 CDD:290367 19/40 (48%)
AT5G01980NP_195818.1 RING_Ubox 350..391 CDD:418438 19/40 (48%)
RING-H2 finger (C3H2C3-type) 350..390 CDD:319361 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.