DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and RIN2

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001328533.1 Gene:RIN2 / 828626 AraportID:AT4G25230 Length:578 Species:Arabidopsis thaliana


Alignment Length:130 Identity:38/130 - (29%)
Similarity:54/130 - (41%) Gaps:37/130 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1118 AIHH--HMFHHHYSPLHLEIGLAPLSLGSRILIAPSRPNRGATLETIERNTLPHKYRRVR----- 1175
            |:.|  |::..|....||..  |.|.|..|.|::       |.|:.|:      .|.::|     
plant   268 ALGHYLHIWWLHGIAFHLVD--AVLFLNIRALLS-------AILKRIK------GYIKLRIALGA 317

  Fly  1176 ----RPSETDEDA----EKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKH----CPICR 1228
                .|..|.|:.    ::||||.   |...:.:||.|.||||..|:..||....:    ||.||
plant   318 LHAALPDATSEELRAYDDECAICR---EPMAKAKRLHCNHLFHLGCLRSWLDQGLNEVYSCPTCR 379

  Fly  1229  1228
            plant   380  379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 17/46 (37%)
zf-RING_2 1187..1228 CDD:290367 17/44 (39%)
RIN2NP_001328533.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.