DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT3G19950

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001326918.1 Gene:AT3G19950 / 821533 AraportID:AT3G19950 Length:386 Species:Arabidopsis thaliana


Alignment Length:263 Identity:69/263 - (26%)
Similarity:106/263 - (40%) Gaps:70/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1046 SSLDPAYYPPYDAAPAAAAPPPSPQQQ---SPATSGS---------------GNSSVAAQASMRH 1092
            ||.|| :.|..:.........|:|.|.   :|.:|.|               ..||.||.:.|..
plant    94 SSADP-FCPICNQGFLEEYEDPNPNQSLNFNPNSSDSFFPMADPFSTLLPLIFGSSAAAPSGMDF 157

  Fly  1093 LQL-QPQQQPQA---QQSPP---------VMQHMQRQRAIHHHMFHHHYSPLHLEIGLA--PLSL 1142
            :.| .|..||||   ||:|.         :..|:|..|:          |..|.|..:.  |...
plant   158 MSLFGPSMQPQARSTQQNPQSDAFDPFTFLQNHLQTLRS----------SGTHFEFVIENHPSDP 212

  Fly  1143 GSRI------------------LIAPSRPNRGATLETIER--NTLPH-KYRRVRRPSETDEDAEK 1186
            |:|:                  .:|.:.|||..|....:.  :.||. |..:....||.::    
plant   213 GNRMPGNFGDYFFGPGLEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQ---- 273

  Fly  1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPN-DALPPSSSGVPDA 1250
            ||:|::.||..::|:::||.|:||.||:..||..:..||:||.::.|..|: :.....|.|..|.
plant   274 CAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDDPDYENRSQGSQGSGDG 338

  Fly  1251 ANS 1253
            ..|
plant   339 QGS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 17/42 (40%)
zf-RING_2 1187..1228 CDD:290367 17/40 (43%)
AT3G19950NP_001326918.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.