Sequence 1: | NP_001262484.1 | Gene: | CG6923 / 41420 | FlyBaseID: | FBgn0037944 | Length: | 1265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001030687.1 | Gene: | AT3G13430 / 820543 | AraportID: | AT3G13430 | Length: | 315 | Species: | Arabidopsis thaliana |
Alignment Length: | 223 | Identity: | 52/223 - (23%) |
---|---|---|---|
Similarity: | 92/223 - (41%) | Gaps: | 53/223 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1080 GNSSVAAQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRA-IHHHMFHHHYSPLHLEIGLAPLSLG 1143
Fly 1144 SRILI---------APS--------RPNRGATLETIERNTLPHKYRRVRRPSETDEDAE------ 1185
Fly 1186 ------KCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICR------------VDIE 1232
Fly 1233 THMPND-------ALPPSSSGVPDAANS 1253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6923 | NP_001262484.1 | zf-rbx1 | <1185..1228 | CDD:289448 | 19/54 (35%) |
zf-RING_2 | 1187..1228 | CDD:290367 | 18/40 (45%) | ||
AT3G13430 | NP_001030687.1 | zinc_ribbon_9 | 7..40 | CDD:405118 | |
RING-H2_RNF126_like | 224..266 | CDD:319581 | 18/41 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1249953at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |