DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT2G44330

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_181961.1 Gene:AT2G44330 / 819040 AraportID:AT2G44330 Length:180 Species:Arabidopsis thaliana


Alignment Length:78 Identity:30/78 - (38%)
Similarity:42/78 - (53%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1178 SETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDALPP 1242
            :.:|:.|..||||...|.:....|||||.||:|.||:..||.::..||:|||::......|    
plant    87 ASSDDSALPCAICREDFVVGESARRLPCNHLYHNDCIIPWLTSHNSCPLCRVELPVASSED---- 147

  Fly  1243 SSSGVP---DAAN 1252
             .||:.   ||.|
plant   148 -DSGLDMWFDALN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 19/42 (45%)
zf-RING_2 1187..1228 CDD:290367 19/40 (48%)
AT2G44330NP_181961.1 RING-H2_RNF126_like 95..137 CDD:319581 19/41 (46%)
RING-H2 finger (C3H2C3-type) 96..136 CDD:319581 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.