DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT2G44330

DIOPT Version :10

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_181961.1 Gene:AT2G44330 / 819040 AraportID:AT2G44330 Length:180 Species:Arabidopsis thaliana


Alignment Length:78 Identity:30/78 - (38%)
Similarity:42/78 - (53%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1178 SETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDALPP 1242
            :.:|:.|..||||...|.:....|||||.||:|.||:..||.::..||:|||::......|    
plant    87 ASSDDSALPCAICREDFVVGESARRLPCNHLYHNDCIIPWLTSHNSCPLCRVELPVASSED---- 147

  Fly  1243 SSSGVP---DAAN 1252
             .||:.   ||.|
plant   148 -DSGLDMWFDALN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 HRD1 <1155..>1256 CDD:227568 30/78 (38%)
RING-H2_RNF111-like 1185..1230 CDD:438137 21/44 (48%)
AT2G44330NP_181961.1 RING_Ubox 95..137 CDD:473075 19/41 (46%)

Return to query results.
Submit another query.